SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000014839 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000014839
Domain Number 1 Region: 6-47
Classification Level Classification E-value
Superfamily Skp1 dimerisation domain-like 0.00000000000000249
Family Skp1 dimerisation domain-like 0.00015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000014839   Gene: ENSMICG00000016297   Transcript: ENSMICT00000016281
Sequence length 47
Comment pep:novel scaffold:micMur1:scaffold_41554:4736:4876:-1 gene:ENSMICG00000016297 transcript:ENSMICT00000016281 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
NKEKRTDDIPVWDQEFLKVDQGTLFELILAANYLDIKGLLDVMCKTV
Download sequence
Identical sequences ENSMICP00000014839 ENSMICP00000014839

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]