SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000014975 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000014975
Domain Number 1 Region: 337-450
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.03e-38
Family Eukaryotic proteases 0.00000869
Further Details:      
 
Domain Number 2 Region: 48-110
Classification Level Classification E-value
Superfamily GLA-domain 7.06e-25
Family GLA-domain 0.0001
Further Details:      
 
Weak hits

Sequence:  ENSMICP00000014975
Domain Number - Region: 219-241
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 0.00951
Family Eukaryotic proteases 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000014975   Gene: ENSMICG00000016427   Transcript: ENSMICT00000016430
Sequence length 453
Comment pep:known_by_projection genescaffold:micMur1:GeneScaffold_806:77369:124134:1 gene:ENSMICG00000016427 transcript:ENSMICT00000016430 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQCLNMIMAESPGLVTICLLGYLLIAECAVFLDRENANKILSRPKRYNSGKLEEFVRGNL
ERECIEEKCSFEEAREVFENTERTTEFWKQYVDGDQCESNPCLNGGSCKDDINSYECWCR
LGFEGKNCELXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPFPCGR
VSVSHTSKFTRAETIFSNMDYENSTEVETILDNVTESTHSPQDITRVVGGENAKPGQFPW
QXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXSHDALELDPLLNSYTLCADREYTNILKFGSGYVSGWGRVFHRGRSASI
LQYLRVPFVDRATCLRSTKVTIHNNMFCAGYHEGGRDSCQGDSGGPHITEVEGTNFLTGI
ISWGEECAMKGKYGIYTKVSRYTNWIKEKTKLP
Download sequence
Identical sequences ENSMICP00000014975 ENSMICP00000014975

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]