SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000015079 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000015079
Domain Number 1 Region: 1-41,87-179,207-356
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.6e-35
Family FAD/NAD-linked reductases, N-terminal and central domains 0.000033
Further Details:      
 
Domain Number 2 Region: 333-461
Classification Level Classification E-value
Superfamily FAD/NAD-linked reductases, dimerisation (C-terminal) domain 3.95e-31
Family FAD/NAD-linked reductases, dimerisation (C-terminal) domain 0.00000723
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000015079   Gene: ENSMICG00000016540   Transcript: ENSMICT00000016543
Sequence length 463
Comment pep:known_by_projection scaffold:micMur1:scaffold_8132:3709:37681:-1 gene:ENSMICG00000016540 transcript:ENSMICT00000016543 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AQLGRKVAVVDYVEPSPRGTRWGLGGTCVNVGCIPKKLMHQAALLGDMVRDARHYGWEVA
EPVPHSWKKMAEAVQNHVKSLNWGHRIQLQDRKVKYFNGIASFVDKHTVRSVTKDGKEAL
LSADHIVIATGGRPRYPTHIEGALEYGITSDDIFWLKESPGKTVFVIWADVALECAGFLT
GIGLDTTVMMRSVPLRGFDQQMSSLVTEHMASHGTRFLRGCTASRVRRLPAGRLQVTWED
RTSGKEDMDTFDTVLWAIGRVPETRSLNLEKSGVETSPDSQKILVDSRDATSVPHIYAIG
DVAEGRPELTPTIMAGRLLAQRLFGQSMALMDYDNVPTTVFTPLEYGCVGLSEEEAVAHH
GQERVEIYHAHYKPLEFTVAERDASQCYIKMVCLREPPQRVLGLHFLGRGAGEVTQGFAL
AIRCGASYAQVTRTVGIHPTCAEEVVRLRISKRSGLDPTVTGC
Download sequence
Identical sequences ENSMICP00000015079 ENSMICP00000015079

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]