SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000015125 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000015125
Domain Number 1 Region: 652-820
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 5.31e-57
Family Translational machinery components 0.0000196
Further Details:      
 
Domain Number 2 Region: 821-907
Classification Level Classification E-value
Superfamily EF-G C-terminal domain-like 1.39e-26
Family EF-G/eEF-2 domains III and V 0.00025
Further Details:      
 
Domain Number 3 Region: 443-560
Classification Level Classification E-value
Superfamily Translation proteins 1.45e-20
Family Elongation factors 0.0024
Further Details:      
 
Domain Number 4 Region: 294-439
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.07e-20
Family G proteins 0.00021
Further Details:      
 
Domain Number 5 Region: 577-650
Classification Level Classification E-value
Superfamily EF-G C-terminal domain-like 1.4e-17
Family EF-G/eEF-2 domains III and V 0.00035
Further Details:      
 
Domain Number 6 Region: 118-236
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.93e-16
Family G proteins 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000015125   Gene: ENSMICG00000016592   Transcript: ENSMICT00000016599
Sequence length 964
Comment pep:known_by_projection genescaffold:micMur1:GeneScaffold_4768:39687:78416:-1 gene:ENSMICG00000016592 transcript:ENSMICT00000016599 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDTDLYDEFGNYIGPELDSDEDDDELGRETKDLDEMDDDDDDDDIGDHDDDHPGMQVVLH
EDKKYYPTAEEVYGPEVETIVQEEDTQPLTXXXXXXXXXXXXXXXXXXXXXXXXXXXFLA
DLMDNSELIRNVTLCGHLHHGKTCFVDCLIEQTHPEIRKRYDQDLCYTDILFTEQEXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXHVNFSDEVTAGLRISDGVVLFIDAAEGXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMYSTDENLIL
SPLLGNVCFSSSQYSICFTLGSFAKIYADTFGDINYQEFAKRLWGDIYFNPKTRKFTKKA
PTSSSQRSFVEFILEPLYKILAQVVGDVDTSLPRTLDELGIHLTKEELKLNIRPLLRLVC
KKFFGEFTGFVDMCVQHIPSPKVGAKPKIEHTYTGGVDSDLGEAMSDCDPDGPLMHTTRL
YSTDDEVHGGVSTHAGQPVKVLGENYTLEDEEDSQICTVGRLWISVARYHIEVNRVPAGN
WVLIEGVDQPIVKTATITEPRGNEEAQIFRPLKFNTTSVIKIAVEPVNPSELPKMLDGLR
KVNKSYPSLTTKVEESGEHVILGTGELYLDCVMHDLRKMYSEIDIKVADPVVTFCETVVE
TSSLKCFAETPNKKNKITMIAEPLEKGLAEDIENEVVQITWNRKKLGEFFQTKYDWDLLA
ARSIWAFGPDATGPNILVDDTLPSEVDKALLGSVKDSIVQGFQWGTREGPLCDELIRNVK
FKILDAVVAQEPLHRGGGQIIPTARRVVYSAFLMATPRLMEPYYFVEVQAPADCVSAVYT
VLARRRGHVTQDAPIPGSPLYTIKAFIPAIDSFGFETDLRTHTQGQAFSLSVFHHWQIVP
GDPLDKSIVIRPLEPQPAPHLAREFMIKTRRRKGLSEDVSISKFFDDPMLLELAKQDVVL
NYPM
Download sequence
Identical sequences ENSMICP00000015125 ENSMICP00000015125

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]