SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000015148 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000015148
Domain Number 1 Region: 267-496
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 1.05e-36
Family FCH domain 0.015
Further Details:      
 
Domain Number 2 Region: 690-772
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 2.55e-18
Family BCR-homology GTPase activation domain (BH-domain) 0.0034
Further Details:      
 
Weak hits

Sequence:  ENSMICP00000015148
Domain Number - Region: 11-62
Classification Level Classification E-value
Superfamily delta-Endotoxin (insectocide), middle domain 0.014
Family delta-Endotoxin (insectocide), middle domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000015148   Gene: ENSMICG00000016616   Transcript: ENSMICT00000016624
Sequence length 1069
Comment pep:known_by_projection genescaffold:micMur1:GeneScaffold_3905:5:13399:1 gene:ENSMICG00000016616 transcript:ENSMICT00000016624 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PTRLSRHDSKTGYRLSGTYTLGRNTRNPLAITSSDELPVEGPSPDAVEDISHLLDDVARF
AEGLEKLKECVLHDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXPHMPLLSIYSLALEQDLEFGHSMVQAVGTLQTQTF
MQPLTLRRLEHEKRRKEIKESWHRAQRKLQEAESNLRKAKQGYVQRCEDHDKARLLVAKA
EEEQAGAAPGTGSTASKTLDKRRRLEEEAKNKAEEAMATYRTCVADAKTQKQELEDTKVT
ALRQLQEVVRQSDQTIKSATISYYQMMHMQTAPLPVHFQMLCESSKLYDPGQQYASHVRQ
LQRGEEPDVHYDFEPHVSANTWSPVMRARKGSFNVGDTAGADTASSPPEEGGSQEGTLAK
DRRGGRGHQVHKSWPISISDSGALDPSASSGDFKKFERTSSSGTMSSNEELADQEGGCRA
SAFEQDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXCCLACHKKCLETLAIQCGHKKLQGRLQLFGQDFSRAARGTPDGVPFLVKKCVCEIER
RALRTKGIYRVNGVKTRVEKLCQAFENGKELVELSQAPPHDISNVLKLYLRQXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXGGSSVQQAEVVVQVPYPEAGEGAAYPLLEEVEDRGEESRVAS
NDSDSELEEASDLLSSSGVSTLRHFNFLEKQESEASLEEGPRSGSGSEEQLETAAREDGD
EDEDSPAPQLSAYNTNQSNNVAWGRLPTVRLQGRRIALGTCGERQPEFV
Download sequence
Identical sequences ENSMICP00000015148 ENSMICP00000015148

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]