SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000015265 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000015265
Domain Number 1 Region: 154-218
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000848
Family Complement control module/SCR domain 0.00019
Further Details:      
 
Domain Number 2 Region: 33-98
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000005
Family Complement control module/SCR domain 0.00016
Further Details:      
 
Domain Number 3 Region: 95-169
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000167
Family Complement control module/SCR domain 0.00021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000015265   Gene: ENSMICG00000016755   Transcript: ENSMICT00000016752
Sequence length 340
Comment pep:novel genescaffold:micMur1:GeneScaffold_4360:2279:60421:1 gene:ENSMICG00000016755 transcript:ENSMICT00000016752 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSLARPSAPTVLRLLSVLLLLXXXXXXXXXXDCSSPPEVPNAHLDLRGLSSFPVNSTVTY
RCNEGFVKVPGQTDSVICLGNDQWSEISEFCNRSCNVSPQLQFAMLKKIYSSQNYFPVGS
TVEYECRLGYRRVPGRSGTLTCLQNLEWSKPAEFCTKKSCTHPGELSNGQINVKTDFLFG
ATINFSCDKGYKLIGAKHSICVIIGDNVGWTEPLPTCRXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKSLTFRVAPSPQKPTTVH
VAATGVSPTPQPSTVHVPATQGELLPRTTMFSPDSSTFIP
Download sequence
Identical sequences ENSMICP00000015265 ENSMICP00000015265

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]