SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000015276 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000015276
Domain Number 1 Region: 19-217
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 5.89e-51
Family BCR-homology GTPase activation domain (BH-domain) 0.0000501
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000015276   Gene: ENSMICG00000016761   Transcript: ENSMICT00000016763
Sequence length 1738
Comment pep:known_by_projection genescaffold:micMur1:GeneScaffold_4624:301109:342537:-1 gene:ENSMICG00000016761 transcript:ENSMICT00000016763 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKSRPTKQKLKQRGILKERVFGCDLGEHLLNSGFEVPQVLQSCTAFERYGIVDGIYRLSG
VASNIQRLRHEFDSEHVPDLTKEPYVQDIHSVGSLCKLYFRELPNPLLTYQLYEKFSDAV
SAATDEERLIRIHDVIQQLPPPHYRTLEFLMRHLSLLADYCSITNMHAKNLAIVWAPNLL
RSKQIESACFSGTAAFMEVRIQSVVVEFILNHVDVLFSGKISAVMQEGAASLSRPKSLLV
SSPSTKLLTLEEAQARTQAQVNSPIVTENKYIEVGEGPAALQGKFHTIIEFPLEXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGRAEGTLRSAKSEESL
TSLHAVDGDSKLFRPRRPRSSSDALSASFNGEMLGNRCNSYDNLPHDNESEEETGLLHIP
ALMSPHSAEDVDLSPPDIGVASLDFDPMSFQCSPPKAESECLESGASFLDSLGYSKDKPS
ASKRDAEAGGSQSQTPGSTASSEPVSPLQEKLSPFFTLDLSPTEEKSSKPSSLTEKVVYA
FSPKIGRKLNKSPSMNISEPISVTLPPRMSDVIGTVSNTAAQNASSPTWDKSVEERDVTN
RSPTQIAKMKTNEREAQEGCESEVQPLDQVAAEEVELPGKEEQSASSSQSKAVASGQTQT
GAVAHDPPQDSVPVSSVSLIPPPPPPKNVARMLALALAESAQQASTQSLKRPGTSQAGYT
NYGDIAVATTEDKLPSSYSAIALDKAYFQTDRPAEQLQLHNGTPGNFDQPLPETTAIGDP
THSNTTESGEQHHQLDWPGNQPHRTYLSGDPEKARITSVPLTDSEKSDDLIRFPEDQSGK
NSMPTVSFLDQDQPPLHFYSGDQPPSYLGTSVDKPHCPSELADKSPTPSNLPRDKIYPPS
GSPEENTSTATLTYMTTTPAIAEMSTREANWDVVEPPTAADFTAATLQRAHRTNRPLPPP
PPQRSTEQPAVVGQVQAATNIGLTNSHKVQGVVPAPERPPEPRAMDDPASVFLSEGSAAA
QCPMATLAAQPGLPEKVREGGRAPLLHLHAESVPVHSCGFTAPVPPTRTMESKIAAAIHF
SSADAASSSNYHSFVTTSSASVDDVLPLPLPVPQPKHASQKTVYSSFARPDVTTEPFGPE
NCLHFSMTPNCQYRPQSVPPHHNKLEPHLVYGARSEPPASVGPRYNTYVAPGRNASGHHS
KPCSRIEYVSSLSSSVRSTCYPEDIPPYPTIRRVQSLHAPPSSMIRSVPISRTEVPPDDE
PAYCPRPLYQYKPYQSSQARSDYHVTQLQPYFENGRVHYRYSPYSSSSSSYYSPDGALCD
VDAYSTVQLRPLHRLPNRDFAFYNPRLPGKNLYSYAGLPSRPRANVTGYFSGNDHNVVSM
PPTADVKHTYTSWDLEDMEKYRMQSIRRESRARQKVKGPVMSQYDNMTPTVQDDLGGIYV
IHLRSKSDPGKTGLLSVAEGKEGRHPAKAISPEGDDRFYRKHPEPELDRAHHHGGYGSTQ
SEKPSLPQKQSSLRNRKLRDMGCSLPEHRAHQEASHRQYCESKNGPPYPQGPGQLDYGSK
GIPDTSEPVSYHNSGAKYATSGQESLRLNHKEVRLSRELERPWARQPPAPEKHSRDCYKE
EEHLPQSVVPPPKPERSHSLKLHHTQNMERDPSMLYQYQPHGKRQSNMTVVSQYDNLEDY
HSLPQHQRGGFGGGDMGTYVPPGFPHPQSRTYATALGQGAFLPAELSLQHPETQIHAE
Download sequence
Identical sequences ENSMICP00000015276 ENSMICP00000015276

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]