SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000015310 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000015310
Domain Number 1 Region: 1517-1763
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.36e-52
Family Ankyrin repeat 0.0000000547
Further Details:      
 
Domain Number 2 Region: 121-244
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000013
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number 3 Region: 302-433
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000188
Family Growth factor receptor domain 0.016
Further Details:      
 
Domain Number 4 Region: 465-507
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000113
Family EGF-type module 0.0036
Further Details:      
 
Domain Number 5 Region: 869-975
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000738
Family Growth factor receptor domain 0.0093
Further Details:      
 
Domain Number 6 Region: 732-769
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000243
Family EGF-type module 0.0033
Further Details:      
 
Domain Number 7 Region: 240-282
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000232
Family EGF-type module 0.0053
Further Details:      
 
Domain Number 8 Region: 1083-1124
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000293
Family EGF-type module 0.011
Further Details:      
 
Domain Number 9 Region: 424-466
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000464
Family EGF-type module 0.015
Further Details:      
 
Domain Number 10 Region: 1131-1163
Classification Level Classification E-value
Superfamily Notch domain 0.0000000863
Family Notch domain 0.0015
Further Details:      
 
Domain Number 11 Region: 1012-1052
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000965
Family EGF-type module 0.014
Further Details:      
 
Domain Number 12 Region: 971-1015
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000123
Family EGF-type module 0.008
Further Details:      
 
Domain Number 13 Region: 85-127
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000148
Family EGF-type module 0.022
Further Details:      
 
Domain Number 14 Region: 6-44
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000193
Family EGF-type module 0.0083
Further Details:      
 
Domain Number 15 Region: 1210-1241
Classification Level Classification E-value
Superfamily Notch domain 0.000000275
Family Notch domain 0.0034
Further Details:      
 
Domain Number 16 Region: 701-733
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000518
Family EGF-type module 0.0087
Further Details:      
 
Domain Number 17 Region: 46-84
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000025
Family EGF-type module 0.018
Further Details:      
 
Domain Number 18 Region: 503-533
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000511
Family EGF-type module 0.01
Further Details:      
 
Weak hits

Sequence:  ENSMICP00000015310
Domain Number - Region: 1173-1204
Classification Level Classification E-value
Superfamily Notch domain 0.00115
Family Notch domain 0.0084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000015310   Gene: ENSMICG00000016769   Transcript: ENSMICT00000016800
Sequence length 2146
Comment pep:known_by_projection genescaffold:micMur1:GeneScaffold_1915:47337:124787:-1 gene:ENSMICG00000016769 transcript:ENSMICT00000016800 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QFCTEDVDECLLQPNACQNGGTCTNRNGGYGCVCVNGWSGDDCSENIDDCAFASCTPGST
CIDRVASFSCMCPEGKAGLLCHLDDACISNPCHKGALCDTNPLNGQYICTCPQGYKGADC
TEDVDECAMANSNPCEHAGKCVNTDGAFHCECLRGYAGPRCEMDINECHSDPCQNDATCL
DKIGGFTCLCMPGFKGVHCELEINECQSNPCVNNGQCVDKVNRFQCLCPPGFTGPVCQID
IDDCSSTPCLNGAKCIDHPNGYEWQCATGFTGVLCEENIDNCDPDPCHHGQCQDGIDSYT
CICNPGYMGAICSDQIDECYSSPCLNDGRCIDLVNGYQCNCQPGTSGVNCEINFDDCAST
PCVHGVCMDGINRYTCVCSPGFTGQRCNIDIDECISNPCRKGATCINDVNGFRCMCPEGP
HHPSCYSQVNECLSNPCIHGNCTGGLSGYKCLCDAGWVGINCEVDKDECLSNPCQNGGIC
DNLVNGYRCTCKKGFKGYNCQVNIDECASNPCLNQGTCLDDIGYTCHCVLPYTXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSCFNGGTCVDGINSFSCLC
PVGFTGPFCLHEINECNSHPCLNEGTCVDGLGTYHCTCPLGYTGKNCQXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXATCSDFIGGYRCECVPGYQGVNCEYEVDECQN
QPCQNGGTCIDLVNHFKCSCPPGTRGLLCEENIDDCAGGPHCLNGGQCVDRIGGYSCHCL
PGFAGERCEGDINECLSSPCSSEGSLDCIQLTNDYLCVCRSTFTGRHCETFVDVCPQMPC
LNGGTCAVASNMPDGFICRCPPGFSGARCQSSCGHVKCRRGEQCVHTSSGPRCFCPDPRN
CESGCASGPCQHGGSCYPQRQPPYYSCQCPPPFWGSRCELYMAPTSTPPATCLSQYCADK
ARDGVCDEACNSHACQWDGGDCSLTMEDPWANCSSPLPCWDYINNQCDELCNTAECLFDN
FECQGNSKTCKYDKYCADHFKDNHCDQGCNSEECGWDGLDCAADRPENLAEGTLVIVVLM
PPEQLLQDARSFLRALGTLLHTNLRIKRDPQGELMVYPYYGEKSAAMKKQRMTRRSLPSE
QEQEVAGSQVFLEIDNRQCVQDSDQCFKNTDAAAALLASQAIQGTLSYPLVSVISESSIP
ERTQLLYLAAVIILFILLGVIMKRKRKHSLLSFTRRDASNHKRREPVGQDAVGLKNLSVQ
VSEANLIGSGTSEHWVDDEGPQPKKVKAEDEALLSEEDDPIDRRPWTQQHLEAADIRRTP
SLALTPPQAEQEVDVLDVNVRGPDGCTPLMLASLRGGSSDMSDEDEDAEDSSANIITDLV
YQGASLQAQTDRTGEMALHLAARYSRADAAKRLLDAGADANAQDNMGRCPLHAAVAADAQ
GVFQILIRNRVTDLDARMNDGTTPLILAARLAVEGMVAELINCQADVNAVDDHGKSALHW
AAAVNNVEATLLLLKNGANRDMQDNKEETPLFLAAREGSYEAAKILLDHFANRDITDHMD
RLPRDVARDRMHHDIVRLLDEYNVTPSPPGTVLTSALSPVICGSNRSFLSLKHTPMGKKP
RRPNTKSTMPTSLPNLAKEAKDAKGSRRKKSLSEKVQLSESSVTLSPVDSLESPHTYVSD
TTSSPMITSPGILQASPNPMLATAAPAAPIHAQHALSFSNLHEMQPLAHGASTVLPSVSQ
LLSHHHIVPPGSGSAGSLGRLHPVTVSADWMNRVEVNEAQYNEMFGMVLAPAEATHPGMA
PQSRPPEGKHMTAPREPLPPIVTFQLIPKGSIAQPVGAPQPQANCPPAVAGPLPTMYQIP
EMARLPSVAFPTAMMPQQDEQVAQTILPAYHPFPASVGXXXXXXXXXXXXXXXXXXXXXX
XSGQSSSPHSASDWSEVTTSPGGAGGGQRGPGTHMSEPPHNNMQVA
Download sequence
Identical sequences ENSMICP00000015310 ENSMICP00000015310

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]