SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000015313 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000015313
Domain Number 1 Region: 199-443
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.68e-63
Family G proteins 0.0000000739
Further Details:      
 
Domain Number 2 Region: 521-624
Classification Level Classification E-value
Superfamily EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain 7.4e-31
Family EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain 0.00016
Further Details:      
 
Domain Number 3 Region: 425-515
Classification Level Classification E-value
Superfamily Translation proteins 2.91e-21
Family Elongation factors 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000015313   Gene: ENSMICG00000016806   Transcript: ENSMICT00000016804
Sequence length 628
Comment pep:known_by_projection scaffold:micMur1:scaffold_7941:53309:55195:1 gene:ENSMICG00000016806 transcript:ENSMICT00000016804 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDPGSSSSDSAPDCWDQVDMETPGLAPSGDGVPSAVAEAQREPLSSAFSRQLNVNAKPFV
PNVHAAEFVPSFLRGPAQPPTPLASFASNDETCTSAGDPQGKWPGRGAPVEPSKEELLVL
CEGSNSAVTMELSEPIVENGEVEMALEESWEHSKEVSEAEPGGGSLGDSGTPEESGQEMM
EEKEEMRKSKSVLIPSGAPKKEHVNVVFIGHVDAGKSTIGGQIMFLTGMVDKRTLEKYER
EAKEKNRETWYLSWALDTNQEERDKGKTVEVGRAYFETEKKHFTILDAPGHKSFVPNMIG
GASQADLAVLVISARKGEFETGFEKGGQTREHAMLAKTAGVKHLIVLINKMDDPTVNWSS
ERYEECKDKLVPFLKKVGFSPKKDIHFMPCSGLTGANIKEQSEFCPWYTGLPFIPYLDNL
PNFNRSIDGPIRLPIVDKYKDMGTVVLGKLESGSIFKGQQLVMMPNKHNVEVLGILSDDT
ETDFVAPGENLKIRLKGIEEEEILPGFILCDPSNLCHSGRTFDVQIVIIEHKSIICPGYN
AVLHIHTCIEEVEITALISLVDKKSGEKSKTRPRFVKQDQVCIARLRTAGTICLETFKDF
PQMGRFTLRDEGKTIAIGKVLKLVPEKD
Download sequence
Identical sequences XP_012611296.1.48125 ENSMICP00000015313 ENSMICP00000015313

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]