SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000015544 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000015544
Domain Number 1 Region: 93-136
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 0.000000353
Family BCR-homology GTPase activation domain (BH-domain) 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000015544   Gene: ENSMICG00000017063   Transcript: ENSMICT00000017060
Sequence length 143
Comment pep:novel genescaffold:micMur1:GeneScaffold_4856:554:4637:1 gene:ENSMICG00000017063 transcript:ENSMICT00000017060 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKKVPPLALIELTALCDVLGLDLKRSKAGKWKAAXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGLEQKLERDFYTGLFSWDEVHHNDASDLL
KRFIRKLPAPLLTAEYPAFAVVP
Download sequence
Identical sequences ENSMICP00000015544 ENSMICP00000015544

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]