SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000015588 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000015588
Domain Number 1 Region: 3-66,102-253
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 8.03e-36
Family FAD/NAD-linked reductases, N-terminal and central domains 0.024
Further Details:      
 
Domain Number 2 Region: 314-453
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.0000000142
Family FAD/NAD-linked reductases, N-terminal and central domains 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000015588   Gene: ENSMICG00000017108   Transcript: ENSMICT00000017108
Sequence length 472
Comment pep:known_by_projection genescaffold:micMur1:GeneScaffold_1325:609662:667269:1 gene:ENSMICG00000017108 transcript:ENSMICT00000017108 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAKKVAVIGAGVSGLISLKCCVDEGLEPTCFERTEDIGGLWRFKENVEDGRASIYQSVIT
NTSKEMSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTTVISVKKCPDFS
SSGQWKVVTQSHGKEQSAIFDAVMVCSGHHILPHIPLKSFPGIERFKGQYFHSRQYKHPG
GFEGKRILVIGIGNSASDIAVELSKKAAXVFISTRHGSWVMSRISEDGYPWDMVFHTRFN
SQLRNVLPRTVLKWMMEQQMNKWLNHENYGLEPQNKYLMKEPILNDDLPSRLLYGAIKVK
PRVKEFTETSAVFEDETVEKDIDVIVFATGYTFSFPFLEESLVKVENNMVSLYKYIFPPH
LEKSTLACIGLIQPLGSIFPTVELQARWVTRVFKGLCSLPSERTMMADVIKRNEKRIDLF
GESQSQILQTNYVDYLDELALEIGAKPALGAILLTDLKLAVKLYFGPCNSYQ
Download sequence
Identical sequences ENSMICP00000015588 ENSMICP00000015588

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]