SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000015864 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000015864
Domain Number 1 Region: 463-521
Classification Level Classification E-value
Superfamily UBA-like 1.5e-19
Family CUE domain 0.0000953
Further Details:      
 
Weak hits

Sequence:  ENSMICP00000015864
Domain Number - Region: 163-362,611-619,656-667
Classification Level Classification E-value
Superfamily ARM repeat 0.0187
Family Armadillo repeat 0.07
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000015864   Gene: ENSMICG00000017414   Transcript: ENSMICT00000017416
Sequence length 754
Comment pep:known_by_projection genescaffold:micMur1:GeneScaffold_715:293480:330115:-1 gene:ENSMICG00000017414 transcript:ENSMICT00000017416 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPALPLDQLQITHKDSKTGKPRTSPALHPEQKADRYFVLYKPPPKDNIPALVEEYLERAT
FVANDLDWLLALPHDKFWCQVIFDETLQKCLDSYLHYVPRKFDEWVAPAPEVVDMQKRLH
RSVFLIFLRMSTHKESKDHFISPSAFGEILYNNFLFDIPKILDLCVLFGKGNSPLLQKMI
GNIFTQQPSYYNDLDETMPTILQVFSNILQHCGLQGDGASTTPQKLEERGRLTPSDMPLL
DLKDVVLYLCDTCTTLWAFLDIFPLACQTFQKHDFCYRLASFYEVAIPEMESAIKKRRLE
DSKLLGDLWQRLSHSRKKLMEIFHIILNQICLLPILESSCDNVQGFIEEFLQIFSSVLQE
KRFLRDYDALFPVTDISLLQQASSVDETRTAYILQAVESAWEGVDRRKASDTKDPSVAEE
PSGKPNGVMVTAEPVSQSSSYPENSEEEECMGAAAALGTTVCGVELDSLISQVKDLLPDL
GEGFILACLEHYHYDPEQVINNILEERLAPPLSQLDHSLDRQVKPDPTPLLTSRHNVFQN
DEFDVFSRDSVDLSRVHKGRSTRKEENTRSLLNDKRSVVEQRQRYEQYSVVVEEVPLQPG
ESLPYHGDDYEDEYDDTYDGNQVGANDADSDDELISRRPFTIPQVLRTKVPGEGQEEEDD
EEEEAEDEAPKPDHFVQDPAVLREKAEARRMAFLARKGYRHDSSTAVAGGPRGHGQSRET
TQERRKKEASKATRANHNRRTMADRKKSKGMIPS
Download sequence
Identical sequences ENSMICP00000015864 ENSMICP00000015864

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]