SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000015889 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000015889
Domain Number 1 Region: 178-368
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.89e-48
Family G proteins 0.00015
Further Details:      
 
Domain Number 2 Region: 499-623
Classification Level Classification E-value
Superfamily Initiation factor IF2/eIF5b, domain 3 8.24e-30
Family Initiation factor IF2/eIF5b, domain 3 0.0015
Further Details:      
 
Domain Number 3 Region: 351-433
Classification Level Classification E-value
Superfamily Translation proteins 3.3e-22
Family Elongation factors 0.012
Further Details:      
 
Domain Number 4 Region: 618-716
Classification Level Classification E-value
Superfamily Translation proteins 1.08e-21
Family Elongation factors 0.00031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000015889   Gene: ENSMICG00000017441   Transcript: ENSMICT00000017441
Sequence length 726
Comment pep:known_by_projection genescaffold:micMur1:GeneScaffold_563:3582:29049:-1 gene:ENSMICG00000017441 transcript:ENSMICT00000017441 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNQKLLKLENLLRFHTVCRQLHSLGQRRALAQWRHGFSSAYPVWAAQLYVRPLQIDMLIG
AALSQYRLLVTKKEERPRKSQLSSTKSKKEIEVWIGMTVEELARAMEKNTXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPQADPALLTPRSP
VVTIMGHVDHGKTTLLDKLRKTQVAAMEAGGITQHIGAFLVSLPSGEKITFLDTPGHAAF
STMRARGAQVTDIVILVVAADDGVMKQTIESIQHAKDAQVPIVLAINKCDKAEADPEKVK
KELLAHDVVCEDYGGDVQAVHVSALTGDNLMALAEATIALAEMLELKADPTGPVEGTVIE
SFTDKGRGPVTTAIIQRGTLRKGSVLVAGKSWAKVRLIFDENGKTINEAYPSMPVGIIGW
RDLPSAGDEILEVESEPRAREVIDWRKYEQEQEKNKEDFKVIEEKRKEHKEAHRKVREKY
SSLHWKERSLKAYLERKEQKPLKPKEKIERDSNTLPVIIKGDVDGSVETLLNIMDTYDAS
HECELELVHFGVGDISENDVNLAETFGGVIYGFNVNASNVIQQSATKKGVKIKLHKIIYR
LIEDLQEELSNRLPCIVEEYPIGEASILATFSVTEGKKKLPVAGCRVQKGQLEKQRKFKL
IRNGHVIWKGLLTSLKHHKDDVSVIKTGMDCGLSLDEEKIEFKVGDQIVCYEEKQVLAKT
SWDPGF
Download sequence
Identical sequences ENSMICP00000015889 ENSMICP00000015889

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]