SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000016016 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000016016
Domain Number 1 Region: 85-160
Classification Level Classification E-value
Superfamily Skp1 dimerisation domain-like 2.49e-31
Family Skp1 dimerisation domain-like 0.00000785
Further Details:      
 
Domain Number 2 Region: 3-70
Classification Level Classification E-value
Superfamily POZ domain 0.0000000000173
Family BTB/POZ domain 0.00026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000016016   Gene: ENSMICG00000017588   Transcript: ENSMICT00000017588
Sequence length 163
Comment pep:novel genescaffold:micMur1:GeneScaffold_506:147646:167083:-1 gene:ENSMICG00000017588 transcript:ENSMICT00000017588 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPSIKLQSSDGEIFEVDVEIAKQSVTIKTMLEXXXXXXXXXXXXXXXXXXXXXXXXXVIQ
WCTHHKDDPPPPEDDENKEKRTDDIPVWDQEFLKVDQGTLFELILAANYLDIKGLLDVTC
KTVANMIKGKTPEEIRKTFNIKNDFTGREEAQVRKENQWCEEK
Download sequence
Identical sequences ENSMICP00000016016 ENSMICP00000016016

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]