SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000016023 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000016023
Domain Number 1 Region: 420-518
Classification Level Classification E-value
Superfamily SRCR-like 1.31e-33
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000016023   Gene: ENSMICG00000017595   Transcript: ENSMICT00000017595
Sequence length 519
Comment pep:known_by_projection genescaffold:micMur1:GeneScaffold_587:1399326:1433177:1 gene:ENSMICG00000017595 transcript:ENSMICT00000017595 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MENKEILKEGELLSSAKGPAAFDQTAMESFEISDPKPRKRSGVNFCIAMVVIYLILLTVG
AGLLLVRVLNLQERLQVVEEMYFPNGTLATEDSPSFSLLQSAQPAAHLPPGASGLRILQA
QLSQVRASQAHLLQRVDNFTRSPELFGIKGERGTTGLPGKRALGTPGILGLPGPAEKGAE
GVRCEGATGPPGPQGPPGIKGAAGLQGPQGAPGKPGAAGAPGRQGEKGSKGDGGLVGPKG
ESGVKGDKGDLGLPGSKGDMGVKGDTGAMGPPGAQGGKGDSGKPGPPGLAGFPGAKGDQG
QPGAQGVPGPPGAAGHPGAKGEPGSTGTPGITGPPGSPGSPGAPGLKGTKGDTGLQGQKG
TKGESGVPGLAGSKGEQGSPGLAGPRGAPGLAGPKGDPGQKGSSGQQGLKGQKGQKGESL
VSVRIVGSSSRGRAEVFYNNIWGTICDDSWDNSDATVFCRMLGYASGRAIYRVGAGTGQI
WLDDVACAGTESSLWNCRKSNWGSHNCNHDEDAGVDCSA
Download sequence
Identical sequences ENSMICP00000016023 ENSMICP00000016023

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]