SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000016073 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000016073
Domain Number 1 Region: 68-292
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 9.62e-76
Family Eukaryotic proteases 0.00024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000016073   Gene: ENSMICG00000017650   Transcript: ENSMICT00000017650
Sequence length 293
Comment pep:known_by_projection genescaffold:micMur1:GeneScaffold_3824:2778:6942:-1 gene:ENSMICG00000017650 transcript:ENSMICT00000017650 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SAGGRPLGLLAWLLILQPRLSEAPAGRPEPPLSHYPLSSGGREDPGAHQAQESPRVLHSS
LFTFTPGDSWLCGRSFLKIVGGQDAEEGKWPWQVSVRIHGRHICGGSLVTSKWVVTAAHC
IISRYHYSVKMGDRSILAENTSLVVPVKKIIVHPKFATFTTVEHDLAILQLVYSVNFTPN
IQPICIPRETFQVESGTRCWVTGWGKTQEGEGFPAKILQEVELSVIRKEKCNEMMQRILL
SSREIIQKGMICGYGGKGKDSCQGDSGGPMACEYNDTWVQVGVVSWGMGCGRE
Download sequence
Identical sequences ENSMICP00000016073 ENSMICP00000016073

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]