SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000016110 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000016110
Domain Number 1 Region: 187-290
Classification Level Classification E-value
Superfamily EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain 2.47e-45
Family EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain 0.0000031
Further Details:      
 
Domain Number 2 Region: 92-221
Classification Level Classification E-value
Superfamily Translation proteins 6.03e-36
Family Elongation factors 0.00000468
Further Details:      
 
Domain Number 3 Region: 1-110
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.75e-16
Family G proteins 0.00015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000016110   Gene: ENSMICG00000017692   Transcript: ENSMICT00000017692
Sequence length 311
Comment pep:novel scaffold:micMur1:scaffold_79280:1355:2290:-1 gene:ENSMICG00000017692 transcript:ENSMICT00000017692 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VNKMDSTEPPYSQKRYEEIVKEVSTYIKKIGYNPDTVAFVPISGWNGDNMLEPSANMPWF
KGWKVTRKDGNASGTTLLEALDCILPPTRPTDKPLRLPLQDVYKIGGIGTVPVGRVETGV
LKPGMVVTFAPVNVTTEVKSVEMHHEALSEALPGDNVGFNVKNVSVKDVRRGNVAGDSKN
DPPMEAAGFTAQVIILNHPGQISAGYAPVLDCHTAHIACKFAELKEKIDRRSGKKLEDGP
KFLKSGDAAIVDMVPGKPMCVESFSDYPPLGRFAVHDMRQTVAVGVIKAVDNKAAGAGKV
TKSAQKAQKAK
Download sequence
Identical sequences ENSMICP00000016110 ENSMICP00000016110

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]