SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000016264 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000016264
Domain Number 1 Region: 364-459
Classification Level Classification E-value
Superfamily EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain 9.11e-30
Family EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain 0.00038
Further Details:      
 
Domain Number 2 Region: 289-362
Classification Level Classification E-value
Superfamily Translation proteins 1.99e-18
Family Elongation factors 0.00037
Further Details:      
 
Domain Number 3 Region: 46-90
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00000000756
Family G proteins 0.0039
Further Details:      
 
Weak hits

Sequence:  ENSMICP00000016264
Domain Number - Region: 216-252
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00523
Family G proteins 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000016264   Gene: ENSMICG00000017858   Transcript: ENSMICT00000017858
Sequence length 471
Comment pep:novel genescaffold:micMur1:GeneScaffold_1761:4955:23354:1 gene:ENSMICG00000017858 transcript:ENSMICT00000017858 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGGEAGVTLGQPHLSRQDLATLXXXXXXXXXXXXXXXXXXXXXXTIGHVAHGKSTVVKA
ISGVHTVRFKNELERNITIKLGYANAKIYKLDDPSCPRPECYRSCGSSTPDEFPTDIPGT
KGNFKLVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTVAEGAPIIPISAQLKYNIEVVCEYIV
KKIPVPPRDFTSEPRLIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVGQEIEVRPGI
VSKDSEGKLMCKPIFSKIVSLFAEHNDLQYAAPGGLIGVGTKIDPTLCRADRMVGQVLGA
VGALPEIFTELEISYFLLRRLLGVRTEGDKKAAKVQLSKNEVLMVNIGSLSTGGRVSAVK
ADLGKIVLTNPVCTEVGEKIALSRRVEKHWRLIGWGQIRRGVTIKPTVDDD
Download sequence
Identical sequences ENSMICP00000016264 ENSMICP00000016264

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]