SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000016274 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000016274
Domain Number 1 Region: 274-297,386-495
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.00000000000851
Family FAD-linked reductases, N-terminal domain 0.06
Further Details:      
 
Domain Number 2 Region: 124-182
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.0000000000939
Family FAD-linked reductases, N-terminal domain 0.058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000016274   Gene: ENSMICG00000017870   Transcript: ENSMICT00000017870
Sequence length 573
Comment pep:known_by_projection genescaffold:micMur1:GeneScaffold_894:4272:29092:1 gene:ENSMICG00000017870 transcript:ENSMICT00000017870 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWTFLGIATFTYFYKKCGDFITLANKELLLCVLVFLSLGLVLSYRCRHRNGGLLGRQRSG
SQFAVFSDILSALPFIGFFWAKTPPGSENKEQLESRRRRKGTNISETTLTGAAASTSVSA
QSDPEVIIVGSGILGSALAAVLSRDGRKVTVIERDLKEPDRIVGEFLQPGGYHVLKDLGL
GXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXELHAPLTVVADGLFSKFRKNLISNKVS
VSSHFVGFLMKNAPQFKANHAELVLANPSPVLIYQISSSETRVLVDIRGEMPSNLREYMV
EKIYPQIPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRGVLLLGDAYNIRHPLTGGGM
TVAFKDVKLWRKLLKGIPDLYDDAAVFQAKKSFYWTRKTSHSFVVNILAQALXXXXSGTD
DSLHQLRKACFLYFKLGGECVAGPVGLLSVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXSEMKYMVH
Download sequence
Identical sequences ENSMICP00000016274 ENSMICP00000016274

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]