SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000000337 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000000337
Domain Number 1 Region: 91-194
Classification Level Classification E-value
Superfamily SH2 domain 4.58e-32
Family SH2 domain 0.0000513
Further Details:      
 
Domain Number 2 Region: 11-91
Classification Level Classification E-value
Superfamily SH3-domain 0.000000000184
Family SH3-domain 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000000337   Gene: ENSMICG00000000370   Transcript: ENSMICT00000000369
Sequence length 262
Comment pep:known_by_projection genescaffold:micMur1:GeneScaffold_501:264528:287864:-1 gene:ENSMICG00000000370 transcript:ENSMICT00000000369 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSLPSRGKTLPSPSSSPSVQGQEPVPVQAERSKATAVALGSFPAGGQTELSLRLGEPLT
IISEGGDWWTVLSEVSGREYNIPSVHVAKVSHGWLYEGLSREKAEELLLLPGNPGGAFLI
RESQTRRGCYSLSVRLSRPASWDRIRHYRIQRLDNGWLYISPRLTFPSLQALVDHYSELA
DDICCLLKEPCVLQRAGPLPGKDIPLPVTVQTTPLNWKELDSSFLFSEASATGEASLLSE
GLRESLSSYISLTEDMSLDDVK
Download sequence
Identical sequences ENSMICP00000000337 ENSMICP00000000337

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]