SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000001001 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000001001
Domain Number 1 Region: 587-637
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000411
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 2 Region: 624-670
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000173
Family Classic zinc finger, C2H2 0.016
Further Details:      
 
Domain Number 3 Region: 105-135
Classification Level Classification E-value
Superfamily SET domain 0.0000085
Family Histone lysine methyltransferases 0.057
Further Details:      
 
Domain Number 4 Region: 147-175
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000809
Family C2HC finger 0.079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000001001   Gene: ENSMICG00000001097   Transcript: ENSMICT00000001100
Sequence length 721
Comment pep:known_by_projection genescaffold:micMur1:GeneScaffold_1184:62248:69706:1 gene:ENSMICG00000001097 transcript:ENSMICT00000001100 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHGTARAAATSVSADCCIPAGLRLGPVPGTFKLGKYLSDRREPGPKKKVLAILTSAPCRL
PPSVRMVRGELVDESGGSPLEWIGLIRAARNPQEQTLEAIADLPGGQIFYRALRDVQPGE
ELTVWYSNSLAQWFDIPTTATPTHDEKGEERYICWYCWRTFRYPNSLKAHLRFHCVLSGG
GGGAFLHHEHAARQGAAPAADGLGLSPKPSAPDFAAPSQTGALRPHPQGPPPPQACGARE
SIKREFSAPLATSPPPGKWGPPKKGKEQLDRALDMSGAARGHSHFVGIVGSSPAGGSGLA
FYPGVRSAFKPAGLARAAVAAHGDSYREESGGKHGAGLALGRLLGGGRAGGRPGSGENPA
AGGAGHHHHHHSHHHHHPKCLLVGDPPPPPPPSGLPCSGALRGFPLLPGPPGKKPAFKHV
ERAPRPAAAALRGARYGRFPPAPGLPIEGCALPAPRRGVFKAFPGWGRRGHRPAARRDFT
VKRGKRLGSQAIPAYPLKLQFGRVVRPESISYFSGPAAAALSPAELGSLASIDREIAMHT
QQLSEMAAGKGRGRLDSGTLPPAVVAAGGAGGGGSGGGGAGKPKTGHLCLYCGKLYSRKY
GLKIHMRTHTGYKPLKCKVCLRPFGDPSNLNKHIRLHAEGNTPYRCEFCGKVLVRRRDLE
RHVKSRHPGQSLLAKAGDGSGAEPGYPPEPGDPKSEDSDVDVCFTDDQSDPEAGGGGERD
S
Download sequence
Identical sequences ENSMICP00000001001 ENSMICP00000001001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]