SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000001410 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000001410
Domain Number 1 Region: 73-199
Classification Level Classification E-value
Superfamily PX domain 0.00000000000000211
Family PX domain 0.0083
Further Details:      
 
Domain Number 2 Region: 840-868
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000279
Family Retrovirus zinc finger-like domains 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000001410   Gene: ENSMICG00000001550   Transcript: ENSMICT00000001553
Sequence length 876
Comment pep:known_by_projection genescaffold:micMur1:GeneScaffold_2261:12041:63925:1 gene:ENSMICG00000001550 transcript:ENSMICT00000001553 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LREHPGGLRSPLRGGPEDAEVEVEPCKFAGSRAQNDSAHGDYVQSNETSLIDQAPIPQDG
LTVAPHRAQREAVHIEKIMLKGVQRKRADKYSEYTFKVNWSDLSVTTVTKTHQELQEFLL
KLPKELSSETFDKTILRALNQGSLKREERRHPDLETILRQLFSTSSQAFLQSQKVHSFFQ
SISSDPLHSLNNLQSSLKTSKILEHLKEDSSEASSQEEDVLQHTVIHKKHTGKSPIVNTI
GTNCSPLDGLTMQYSEQNGIVDWRKQSCTTIQHPEHCVTLADQHSAEKRSLSSLNKKKGK
TQIEKEKIKKTDNRLNSRVNGIRLSAPQHAHGGTVKDVNLDIGSGHDTCGETSSESYSSP
SSPRHDGRESFESEEEKDRDTDSNSEDSGNPSTTRFTSYGSVNQTVTVKPPVQIASLGNE
SGSLLDDPLNAPKYQHISFMPTLHCVMHNGAQKSEVVVPTPKSADGKTIGMLVPSPVDIS
AIRESTNSTPVGILGPTASTGESEKHLELLASPLPIPSTFLPHSSTPALHLTLQRLKLPP
PQGSSESCTVNIPQQPTGSLSIGSPNTAFIPVHNPGSFPGSPVATTDPITKSASQVVGLN
QMVPQIEGNTGTVPQPTNVKVVLPAAGLSATQPPASYTLPGSPLAASVLPSQNSSVLNTA
APSPQPASAGLSQAQATAPPAVPTHTPGPAPSPSPALTHSTAQSDSTSYISAVGNTNANG
TVVPPQQMGSGPCGSCGRRCSCGTNGNLQLNSYYYPNPVPGPMYRVPFFTLPSICNGSYL
NQAHQSNGNQLPFFLPQTPYANGLVHDPVMGSQASYGLQQMTGFGRFYPVYPAPNVVANT
SGSGPKKNGNVSCYNCGVSGHYAQDCKQSSMEANQQ
Download sequence
Identical sequences ENSMICP00000001410 ENSMICP00000001410

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]