SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000001426 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMICP00000001426
Domain Number - Region: 68-113
Classification Level Classification E-value
Superfamily AMPKBI-like 0.0471
Family AMPKBI-like 0.011
Further Details:      
 
Domain Number - Region: 3-29
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0518
Family variant PHD-like domain 0.063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000001426   Gene: ENSMICG00000001571   Transcript: ENSMICT00000001569
Sequence length 153
Comment pep:known_by_projection genescaffold:micMur1:GeneScaffold_1406:8736:30566:1 gene:ENSMICG00000001571 transcript:ENSMICT00000001569 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GNQELFPCDVCGRRFAADVLERHGPICKKLFNKKRKPFNSLKQRLQGTDIPTVRNAAQSE
SQPVKKPNWRQQHEEFINVIRSAKQYSLAIKEGRPLPPLLPPSLNLDYIQCPYCMRKFNE
TASQRHVNFCKDQSSRRVFDPAQTAANLGSRGQ
Download sequence
Identical sequences ENSMICP00000001426 ENSMICP00000001426

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]