SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000001728 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000001728
Domain Number 1 Region: 236-345
Classification Level Classification E-value
Superfamily SRCR-like 6.54e-38
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00038
Further Details:      
 
Domain Number 2 Region: 135-238
Classification Level Classification E-value
Superfamily SRCR-like 1.18e-33
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00046
Further Details:      
 
Domain Number 3 Region: 20-128
Classification Level Classification E-value
Superfamily SRCR-like 3.01e-30
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000001728   Gene: ENSMICG00000001897   Transcript: ENSMICT00000001895
Sequence length 345
Comment pep:known_by_projection genescaffold:micMur1:GeneScaffold_1851:125192:135115:-1 gene:ENSMICG00000001897 transcript:ENSMICT00000001895 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALLFFLILAICTRPGLLESPFTVRLVGGSHRCEGRVEVEQEGRWHLVCDDDWDKNDVAV
VCRELGCGAAKKALSGFLYKPPPEQWQEFLFQNVNCSGMEDALAHCEKDEGDIDCSIEEA
AGALCENPDSPVFEEVRLADGPGRCKGRVEVKYQDQWSPVCKTGWNLRAAKVVCHQLGCG
RAILAQKHCSKAAQSQGPIWLNQISCSGKETALQDCPSEPWGKNNCTYEDHVWVECEDVF
DLRLVGGDKRCSGRLEVFHKGVWGSVCDDGWGKKEDQVVCKQVGCGKSLSPSSKVRKSYG
PGVGRIWLDDVRCSGDEQSLEQCKHRFWGYHDCTHKEDVAVICSE
Download sequence
Identical sequences ENSMICP00000001728 XP_012604194.1.48125 ENSMICP00000001728

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]