SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000001849 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000001849
Domain Number 1 Region: 53-119
Classification Level Classification E-value
Superfamily Rap30/74 interaction domains 4.97e-16
Family Rap30/74 interaction domains 0.000025
Further Details:      
 
Domain Number 2 Region: 212-243
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.000000816
Family DNA-binding domain from rap30 0.00077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000001849   Gene: ENSMICG00000002021   Transcript: ENSMICT00000002022
Sequence length 250
Comment pep:known_by_projection genescaffold:micMur1:GeneScaffold_4284:101:65419:1 gene:ENSMICG00000002021 transcript:ENSMICT00000002022 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAERGELDLTGAKQNTGVWLVKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVSFTLN
EDLANIHDIGGKPASVSTPREHPFVLQSVGGQTLTAFTESSSDKLSLEGIVVQRAECRPA
ASENYMRLKRLQIEESSKPVRLSQQLDKVVTTNYKPVANHQYNXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGYLKEILKEIGVQNVKGIHKNTWELKPEY
RHYQGEEKSD
Download sequence
Identical sequences ENSMICP00000001849 ENSMICP00000001849

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]