SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000001959 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000001959
Domain Number 1 Region: 1154-1329
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.59e-52
Family BCR-homology GTPase activation domain (BH-domain) 0.000033
Further Details:      
 
Domain Number 2 Region: 929-1052
Classification Level Classification E-value
Superfamily PH domain-like 3.29e-32
Family Pleckstrin-homology domain (PH domain) 0.000000459
Further Details:      
 
Domain Number 3 Region: 35-158
Classification Level Classification E-value
Superfamily PDZ domain-like 2.5e-18
Family PDZ domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000001959   Gene: ENSMICG00000002125   Transcript: ENSMICT00000002139
Sequence length 1944
Comment pep:known_by_projection genescaffold:micMur1:GeneScaffold_1460:417716:553271:-1 gene:ENSMICG00000002125 transcript:ENSMICT00000002139 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATRRTGLPEGDGDKLKAFEVSKNKDGKEQSETVSPSEDETFAWPGPKTVMLKRTSQGFG
FTLRHFIVYPPESAIQFSYKDEENGNRGGKQRNRLEPMDTIFVKQVKEGGPAFEAGLCTG
DRIIKVNGESVIGKTYSQVIALIDSDTTLELSVMPKDEDILQVLFTKDVTALAYSQDAYL
KGNEAYSGNARNIPEPPPICYPWLPPAPPATAQPAEISPPDSSLSKHQTSTPVLVQPGRA
YRMEIQVPPSPTDVAKSNTAVCVCNESVRTVIVPSEKVVDLLSNRNTHAGPSHRTEEVRY
GMNEQTSLKTVSRTTSPPSSIPTAHLIHQTTGSRSLEPSRILLKSGNYSGHSEGISSSRP
QAVDSSSVSVNHYSPNSHQHIDWNYKTYKEYIDRRSHIGCRTIQERLDSLRAASQNTTDY
QVVPNRTTLQVRRRSTSHDRVPQSVQIRQRSVSQERLEDSVLMKYCPRSASQGALTSPSV
SFSNHRTRSWDYIEGQGETVENVNSESQTPDSNGERKQTYKWSGFTEQDDRRGIYERPRQ
QEVHKSFQGSNFTVAPSVVNSDNRRMVAGRGVGSVSQFKKIPPDLKTLPPNRNFQATCGM
SLPQGMSQERSPLVKVRSSSLKAPSTHVTKPSFSQNSFVSMKDQRPVNHLHQNSLLSQQA
WLRTESVPDQHVETGKSPPFSGASAKPTPQMSDNSGPPDLELPVSPANQDLNLQEADIQQ
SDALDNKETVILREKPPSGRQTPQPLRHQSYILAVNDQETGSDTTCWLPNDARREVHIKR
MEERKASSTSPPGDSLASIPFIDEPTSPSIDHDIAHIPASAVISASTSQVPSIATVPPSL
TTSAPLIRRQLSHDHESVGPPSLDAQPSSKTERSKSYDEGLDDYREDAKLSFKHVSSLKG
IKISDSQKSSEDSGSRKDSSSEVFSDAAKEGWLHFRPLVTDKGKRVGGSIRPWKQMYVVL
RGHSLYLYKDKREQTTPSEEEQPISVNACLIDISYSETKRKNVFRLTTSDCECLFQAEDR
DDMLAWIKTIQESSNLNEEDTGVTNRDLISRRIKEYNSLMSKAEQLPKTPRQSLSIRQTL
LGAKSEPKTQSPHSPKEESERKLLSKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXYIPLIVDICCKLVEERGLEYTGIYRVPGNNAAISSMQEELNKGMAD
IDIQDDKWRDLNVISSLLKSFFRKLPEPLFTNDKYADFIEANRKEDPLDRLKTLKRLIHD
LPEHHYETLKFLSAHLKTVAENSEKNKMEPRNLAIVFGPTLVRTSEDNMTHMVTHMPDQY
KIVETLIQHDWFFTEEGAEEPLTTVQEENTVDSQPVPNIDHLLTNIGRTGVSPGDVSDSA
TSDSTKSKGSWGSGKDQYSRELLVSSIFAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKRKSIGLRYIMAG
HGAGTSFQNFRQVQDKDAGREDEVFYVNANPRGAQDLCILDLARGGPRNSASDGATPDPA
PEHPRVPETPATDAPLSFQSDTGSSSSTSASTHRPPLSTPPQPSDQVNGESFQNSSRNAT
AAVHAQPRKLSETPGGKAQFHPCL
Download sequence
Identical sequences ENSMICP00000001959 ENSMICP00000001959

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]