SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000001985 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000001985
Domain Number 1 Region: 150-403
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 5.56e-85
Family Eukaryotic proteases 0.0000000133
Further Details:      
 
Domain Number 2 Region: 60-157
Classification Level Classification E-value
Superfamily SRCR-like 0.0000000000000222
Family Hepsin, N-terminal domain 0.00000376
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000001985   Gene: ENSMICG00000002167   Transcript: ENSMICT00000002168
Sequence length 415
Comment pep:known_by_projection genescaffold:micMur1:GeneScaffold_964:782:9732:1 gene:ENSMICG00000002167 transcript:ENSMICT00000002168 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEKEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQVGAVD
ARLAVFDRTEGTWRLLCSSRSNARAAGLGCEEMGFLRALAHSELDVRTAGANGTSGFFCV
DEGRLPHAQRLLEVISVCDCPRGRFLAAICQDCGRRKLPVDRIVGGQDSSLGRWPWQVSL
RYDGAHLCGGSLLSGDWVLTAAHCFPERNRVLRWRVFAGAVAQASPQALQLGVQAVVYHG
YLPFRDPNSEENSNDIALVHLSSPLPLTEYIQPVCLPAAGQALVDGKICTVTGWGNTQYY
GQQAGVLQEARVPIISNDVCNGPDFYGNQIKPKMFCAGYPEGGVDACQGDSGGPFVCEDG
ISRTPRWRLCGIVSWGTGCALAQKPGVYTKVSDFREWIFQAIKTHSEASGMVTQL
Download sequence
Identical sequences ENSMICP00000001985 ENSMICP00000001985

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]