SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000002341 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000002341
Domain Number 1 Region: 174-256,301-409
Classification Level Classification E-value
Superfamily NAD kinase/diacylglycerol kinase-like 0.00000000262
Family Diacylglycerol kinase-like 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000002341   Gene: ENSMICG00000002561   Transcript: ENSMICT00000002564
Sequence length 421
Comment pep:known_by_projection genescaffold:micMur1:GeneScaffold_37:7013:80980:1 gene:ENSMICG00000002561 transcript:ENSMICT00000002564 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTVFFKTLRNHWKKTTAGLCLLTWGGHWLYGKHCDNLLRRAACQEAQVFGNQLIPPNAQV
KKATVFLNPAACKGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXVVTGVLQRTDEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXHITDAAL
AIVKGETVPLDVLQIKGEKEQPVFAMTGLRWGSFRDAGVRVSNYWYLGPLKTKAAHFFST
LKEWPQTHQASISYTGPTERSPSEPEETSPRPSLYRRILRRLASFWAQPQDAPSQEVSPE
VWKEVQLSTIELSITTRNSQLDLTSKEDFMNICIEPDAVSKGDFITIGSKKVRDPKLHAE
GTTCLQASQCALLLPEGTGGSFSIDSEEYEAMPVEVKLLPRKLQFFCDPRKREQGLQSTA
Q
Download sequence
Identical sequences ENSMICP00000002341 ENSMICP00000002341

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]