SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000002543 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000002543
Domain Number 1 Region: 244-482
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 3.98e-63
Family Eukaryotic proteases 0.000000182
Further Details:      
 
Domain Number 2 Region: 45-162
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 8.9e-26
Family Spermadhesin, CUB domain 0.00024
Further Details:      
 
Weak hits

Sequence:  ENSMICP00000002543
Domain Number - Region: 190-229
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000572
Family Complement control module/SCR domain 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000002543   Gene: ENSMICG00000002796   Transcript: ENSMICT00000002792
Sequence length 486
Comment pep:known_by_projection genescaffold:micMur1:GeneScaffold_3974:49474:70727:-1 gene:ENSMICG00000002796 transcript:ENSMICT00000002792 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPGRRWGNYPWRRPHSAGCPGKMWWLLLWGVLQACPTQGSVLSAQQLSQQLTSPGYPEPY
VKGQQSTVDIEAPEGFAVRLVFQDFDLEPSRDCERDSVTISAGGTDLSRFCGLQGSPLGS
PPGQREFVSSGRSLRLTFHTHSSSEDKATHLHRGFLALYQAVAVSCRQPTSWASVGSEAI
STPGDSPAEIQNPCQEPYYQAVAAGTLTCKAPGTWKDREGREEAPRCVPXXXXXXXXXAQ
NQTTPGSPRAKLGNFPWQAFTSIYGRGGGALLGDRWILTAAHTIFPKDSVSLRRKLSVHV
FLGHTDINEMLKLGSYPVRRVVVHPDYRQNESHNFNADIALLELQRSVPLGPLVLPVCLP
DSETLYASGVQGYVSGFGVEMGWLTTKLKYSRLPVAPREACEAWLRGKRRTEVFSDNMFC
VGDEIQKNGVCQGDSGSVYVVWDDHARRWVATGIVSWGIGCNTGYGFYTKVLNYLDWIQG
VMDGRD
Download sequence
Identical sequences ENSMICP00000002543 ENSMICP00000002543

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]