SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000002612 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000002612
Domain Number 1 Region: 1466-1514,1592-1706
Classification Level Classification E-value
Superfamily FAS1 domain 6.67e-28
Family FAS1 domain 0.0027
Further Details:      
 
Domain Number 2 Region: 1707-1861
Classification Level Classification E-value
Superfamily FAS1 domain 9.03e-26
Family FAS1 domain 0.0053
Further Details:      
 
Domain Number 3 Region: 2188-2268
Classification Level Classification E-value
Superfamily C-type lectin-like 5.83e-23
Family Link domain 0.001
Further Details:      
 
Domain Number 4 Region: 962-1118
Classification Level Classification E-value
Superfamily FAS1 domain 1.57e-20
Family FAS1 domain 0.0061
Further Details:      
 
Domain Number 5 Region: 385-496
Classification Level Classification E-value
Superfamily FAS1 domain 2.09e-19
Family FAS1 domain 0.0061
Further Details:      
 
Domain Number 6 Region: 526-644
Classification Level Classification E-value
Superfamily FAS1 domain 6.54e-17
Family FAS1 domain 0.0028
Further Details:      
 
Domain Number 7 Region: 2296-2449
Classification Level Classification E-value
Superfamily FAS1 domain 0.0000000000017
Family FAS1 domain 0.0091
Further Details:      
 
Domain Number 8 Region: 1125-1247
Classification Level Classification E-value
Superfamily FAS1 domain 0.00000000122
Family FAS1 domain 0.0084
Further Details:      
 
Domain Number 9 Region: 1538-1575
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000935
Family Merozoite surface protein 1 (MSP-1) 0.058
Further Details:      
 
Weak hits

Sequence:  ENSMICP00000002612
Domain Number - Region: 870-908
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000488
Family EGF-type module 0.061
Further Details:      
 
Domain Number - Region: 230-283
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000572
Family EGF-type module 0.041
Further Details:      
 
Domain Number - Region: 900-958
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00117
Family EGF-type module 0.026
Further Details:      
 
Domain Number - Region: 2129-2165
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00307
Family EGF-like domain of nidogen-1 0.057
Further Details:      
 
Domain Number - Region: 1364-1491
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00753
Family Growth factor receptor domain 0.017
Further Details:      
 
Domain Number - Region: 198-231
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0184
Family Merozoite surface protein 1 (MSP-1) 0.066
Further Details:      
 
Domain Number - Region: 827-859
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0435
Family EGF-type module 0.041
Further Details:      
 
Domain Number - Region: 321-357
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0502
Family EGF-type module 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000002612   Gene: ENSMICG00000002842   Transcript: ENSMICT00000002869
Sequence length 2559
Comment pep:known_by_projection genescaffold:micMur1:GeneScaffold_622:526690:555006:1 gene:ENSMICG00000002842 transcript:ENSMICT00000002869 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGPRGLLLLCLLAFFLAGFSFVRGQKVRSKRCDTMTKYVTHVPCTSCAVIKKRACPVGW
LRELPEKISQGCRYEVQLGDSVVSMPGCSRECWKDVVQKACCPGYWGSQCYECPGAETPC
NGHGTCLDGMASNGTCVCQENFSGSPCQECQDPNRFGPDCQSVCSCVHGMCNHGPLGDGS
CLCFAGYTGPRCDQELPACQALRCPPNSQCSAEAPTCRCLPGHTQQGSECRAPDPCQPSP
CSPLARCSASPKGQAQCHCPENYHGDGVVCLPQDPCTINFGGCPSNSTLCLYQKPGKASC
TCRPGLVSTNRGTSAGCFAFCSPHSCDKSATCQLTPSGKTSCVCKEGEVGDGRACYGHLL
HEVQKAGQIGLVPLLLRPAVAMLDQGCREILTTSGPFTVLVPSSISSRTLNASLAQQLCR
QHIIAGQHILEDMGTQKSRRWWTLAGQEITVTFSSFTKYTYKYGDQPQQTFNIQRANYVA
ANGVFHLVTGLRWQPPSGTSGDPTXXXXXXXXXXXXXXXXXXXXXNCGLPSILDGPGPFT
VFAPSNKAVDSLRDGRLIYLFTAGLSKLQELVRYHVYSHGQLTIXXXXXXXXXXXXXXXX
XXXXXXXXGRILLGPEGVPLRRVDVQAANGVIHMLEGILLPPTILPILPKHCSEEQHKIV
PGSCVDCQALNTSMCPPHSVRLDLYPKECVYIHDPTGLNMLKKGCASYCNQTVTKLGCCK
GFFGPDCTQCPGGFSNPCYGKGNCSDGIQGNGVCLCFPDYKGIACHICSNPNKHGDQCQE
DCGCVHGLCDNRPGSGGVCQHGTCVLGFTGRFCNETVGDCGPTGLAQHCHLHARCVSQGG
VARCLCLDGFEGDGFSCTPSNPCSHPNRESCSENAECVPGALGTYRCTCHKGWSGDGRIC
VAIDECELDGRGGCHTDALCSYVGPGQSRCTCKLGFAGDGYECSPIDPCRAGNGGCHGLA
TCRAVGGGQRICTCPPGFGGDGFSCYGDISRELEANAQFSGFYQWFKSAGITLPIDGRVT
ALVPSEAAIRRLSPEDQAFWLQPRVLPKLVRAHFLQGALCEEELARLGGQDVATLSPTTR
WEIHNISGRVWVQNASVDVADLLATNGVLHILSQVLLPSRGDTQGGLLQQLALVPAFSLF
CELLQRHRLVSQIEAATAYTIFVPTNHSLEGNSSSLDADTVRHHVVLGEALSVEALRRGG
HRNSLLGPAHWLVFYNHSGQPEVNHVPLEGPVLEAPGRSLFGLSGVLTVGSSRCLHSHAE
ALREKCVNCTRKFRCTQGFQLQDTPKKSCLYRSGFSFSRGCSYTCAKKIQVPDCCPGFFG
TLCEPCPGGLGGVCSGHGQCQDRLLGSGECRCHEGFHGTACEMCELGRYGPNCTGVCDCA
YGLCQEGLRGDGSCVCNVGWQGLRCDQKITGPQCSKKCDPNANCVQDSAGAPTCVCAAGY
SGNGTYCSEVDPCVHGHGGCSPYANCTKVAPGQRTCTCQDGYMGDGELCQEINSCLIHHG
GCHSHAECIPTGPQQVSCICREGYSGDGIRTCELLDPCSQSNGGCSPYAVCKSTGDGQRT
CTCDTAHTVGDGFTCRARVGLELLRDRHASFFSLHLLEYKELRGNGPFTVFVPHTDLMAN
LSQDELARIRAHRQLAFRYHVVGCRQLRSQELLDQEYATALSGHTLRFSEREGSIYINDF
ARVVSSDHEAVNGVLHFIDRVLLPPDALHWEPDAVPVPRRNVTAAAESFGYKILSGLLSV
AGLLPLFQDASHRPLTMLWPTDSALRALPPDRQAWLYHEDHRDKLAAILQGHVIRNVEVL
SSDLPNLGPLRTMHGTPISFSCSRARPGELMVGEDDARIVQRHLPFEGGLAYGIDQLLEP
PGLGARCDLLETRLLQRKTCSICGLEPPCPEGSQEQGSPEACWRYFSKFWVSPPLRSLAL
RSIWARPSLWGQPQGWRRGCHRNCVTTTWKPNCCPGHYGSECQXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXLQTVCASPCARRMYREGNSCECSSYEGGRKTTMADMYQNGHVGCSHANCSQ
VGTVITCTCLPDYEGDGWSCRARNPCAESHRGGCSEHADCLSTGPNTRRCECHAGYVGDG
LQCLEELEPPVDRCLGQPPPCHVDAVCTDLHFQEKRAGVFHLQATGGPYGLNFSEAEAAC
GAQGAVLASLPQLSAAQQLGFHLCLMGWLANGSAAHPVIFPAADCGDGQGIVSLGAXXXX
XXXXXXXXXXXXXXXXRCRDGFVGDGISTCNEKLDVLAATANFSTFYGMLLGYANATQRG
LDFLDFLNDELTYKTLFVPVNEGFLDNMTLSGPDLELHASNITFLSTNASLGKLLPAYSG
LSLAVRDMGPDNSSWAPVAPGAVAVSHVIVWDIMAFNGIIHALASPLLTPPQSWAVLAPE
APPVAAGVGAAVATGVLLGLVAGALYLRARGKPAGFGFSTFQAEDDADDDFSPWQEGTSP
TLVSVPNPVFGSHDAFCEPFDDALLEEDFPDTQRILTVK
Download sequence
Identical sequences ENSMICP00000002612 ENSMICP00000002612

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]