SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000003017 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000003017
Domain Number 1 Region: 325-574
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 7.06e-66
Family Eukaryotic proteases 0.00074
Further Details:      
 
Domain Number 2 Region: 260-294
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000144
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 3 Region: 113-165
Classification Level Classification E-value
Superfamily SRCR-like 0.0000000458
Family Scavenger receptor cysteine-rich (SRCR) domain 0.032
Further Details:      
 
Domain Number 4 Region: 225-257
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000668
Family LDL receptor-like module 0.0025
Further Details:      
 
Domain Number 5 Region: 56-108
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.0000000884
Family Ovomucoid domain III-like 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000003017   Gene: ENSMICG00000003323   Transcript: ENSMICT00000003320
Sequence length 583
Comment pep:known_by_projection genescaffold:micMur1:GeneScaffold_4693:5736:63069:-1 gene:ENSMICG00000003323 transcript:ENSMICT00000003320 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKLVHIFLFLLCFYLNFCKTLTSDLSQEDLVEKKCLAKKYTHLSCNKVFCQPWQKCIDGT
CVCKLPYQCPKNGTEVCATNGRKYPTYCHVKSLECLQPTTKFLHNGTCKAGGKFSVSLYG
NTNSEGIVEVKLVDQDTKTFVCERSWSVREANVACLELGFQXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLPADESFQCVNGKYISQTK
ACDGVNDCGDQSDELCCKGCRGDSFLCKSGVCIPSQYRCNGEVDCITGDDEVNCEXXXXX
XXXGTEILTVDMNAERKRIKASLPKLSCGVKSSVPARRKRVVGGTPAHHEDFPWQVGIKE
AQGISCGGIYIGGCWILTAAHCVRVSKTHRYQIWTSLLDWIKPNAEIKVELVNRIIIHEK
YNASTYQNDIALIEMKGYPNPKHCELPKSVPACVPWSPYLFQPNDRCIVSGWGRGKDNQR
VHSLKWGAVNLIGNCSKFYPNRFYEKEMECAGTVDGSIDACKGDSGGPLVCLDANNVTYV
WGVVSWGENCGKPEFPGVYTKVANYFDWIGHHVGRSLISQYNI
Download sequence
Identical sequences ENSMICP00000003017 ENSMICP00000003017

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]