SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000004525 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000004525
Domain Number 1 Region: 316-454
Classification Level Classification E-value
Superfamily PapD-like 1.47e-37
Family MSP-like 0.000000225
Further Details:      
 
Domain Number 2 Region: 103-247
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 2.49e-20
Family CRAL/TRIO domain 0.0061
Further Details:      
 
Domain Number 3 Region: 38-75
Classification Level Classification E-value
Superfamily CRAL/TRIO N-terminal domain 0.00000196
Family CRAL/TRIO N-terminal domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000004525   Gene: ENSMICG00000004964   Transcript: ENSMICT00000004963
Sequence length 514
Comment pep:known_by_projection genescaffold:micMur1:GeneScaffold_3943:114266:307655:1 gene:ENSMICG00000004964 transcript:ENSMICT00000004963 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
NHAQNKAKLISETRRRFEAECITDKSDKYDPRDVERLQQDDNWVESYLHWRHDSVDETLK
MLDESFQWRKEISVNXXXXXXXXXXXXXXXXXXXXXXXXXXXKLFWIRVKYHTKDQKTIP
DKKKLIAFWLERYAKRENGKPVTVMFDLSETGINSIXXXXXXXXXXXXXXXXXXXXXKIV
IFDMPWLMNAAFKIVKSWLGPEAVSLLKFTSKNEVQDYVSVEYLPPHMGGTDPFKYSYPP
LVDDDFQTPLCENGPITSEDETSSKEDIESDGKETLETISNEEQTTLLKKTNPTESTSKA
EENEKVDSKIKAFKKPLSVFKGPLLHISPAEELYFGSTESGEKKTLIVLTNVTKNIVAFK
VRTTAPEKYRVKPSNSSCDPGASVDIVVSPHGGLTVSAQDRFLIMAAEMEQSSGTGPAEL
TQFWKEVPRNKVMEHRLRCHTVENSKPNTLTLKDNAFNMSDKTSEDIYLQLNRLLESNRK
LEDQVQHCIWFQQLLLSLTVLLLAFVISFFYLLS
Download sequence
Identical sequences ENSMICP00000004525 ENSMICP00000004525

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]