SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000004700 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000004700
Domain Number 1 Region: 2-168
Classification Level Classification E-value
Superfamily L domain-like 2.65e-42
Family Ngr ectodomain-like 0.026
Further Details:      
 
Domain Number 2 Region: 89-167,263-405
Classification Level Classification E-value
Superfamily L domain-like 1.02e-40
Family Internalin LRR domain 0.04
Further Details:      
 
Domain Number 3 Region: 448-744
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 1.28e-33
Family Rhodopsin-like 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000004700   Gene: ENSMICG00000005157   Transcript: ENSMICT00000005156
Sequence length 865
Comment pep:known_by_projection genescaffold:micMur1:GeneScaffold_1917:1060228:1085120:-1 gene:ENSMICG00000005157 transcript:ENSMICT00000005156 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QLAGNDLSFIHPKALSGLKELKVLTLQNNQLKTVPSEAIRGLSALQSLRLDANHITSVPE
DSFEGLVQLRHLWLDDNSLTEVPVRPLSNLPTLQALTLALNKISSIPDFAFTNLSSLVVL
HLHNNKIKSLGQHCFDGLDNLETLDLNYNNLEEFPQAIKALPSLKELXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTL
TGTTISSIPNXXXXXXXXXXXXDLSYNNIKDLPSFNGCHALEEISLQRNQISQIKEGTFQ
GLRSLRILDLSRNLIHEIHSRAFAKLGPITNLDVSFNELTSFPTEGLNGLNQLKLVGNFK
LKEALAAKDFVNLRSLSVPYAYQCCAFWGCESYANLNTEDNSLQDHSVAKEKGTADAANI
TSNAENEEHSQIIIHCTPSTGAFKPCEYLLGSWMIRLTVWFIFLVALFFNLLVILTTFAS
YTSLPSSKLFIGLISVSNLFMGIYTGILTFLDAVSWGRFAEFGIWWETGNGCKAAGFLAV
FSSESAIFLLMLATVERSLSAKDVMKNGKSNHLKQFRVAVLFAFLCAAVAGCFPLFHRGE
YSASPLCLPFPTGEAPSLGFTVTLVLLNSLAFLLMAIIYTKLYCNLEKEDLSENSQSSMI
KHVAWLIFTNCIFFCPVAFFSFAPLITAISISPEIMKSVTLIFFPLPACLNPVLYVFFNP
KFKEDWKLLKRRVTKKNGSVSVSISSQGGCVEQDFYYDCGMYSHLQGNLTMCDCCESFLL
TKPVSCKHLIKSHSCPALAVASCQRPEGYWSDCGTQSAHSDYADEEDSFVSDSSDQVQAC
GRACFYQSRGFPLVRYAYNLPRVKD
Download sequence
Identical sequences ENSMICP00000004700 ENSMICP00000004700

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]