SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000005488 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000005488
Domain Number 1 Region: 35-123
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 3.85e-36
Family SCAN domain 0.0000536
Further Details:      
 
Domain Number 2 Region: 438-494
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.03e-22
Family Classic zinc finger, C2H2 0.0043
Further Details:      
 
Domain Number 3 Region: 479-531
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.19e-19
Family Classic zinc finger, C2H2 0.0035
Further Details:      
 
Domain Number 4 Region: 383-439
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.88e-19
Family Classic zinc finger, C2H2 0.0098
Further Details:      
 
Domain Number 5 Region: 344-396
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.52e-18
Family Classic zinc finger, C2H2 0.0069
Further Details:      
 
Domain Number 6 Region: 222-256
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.000034
Family KRAB domain (Kruppel-associated box) 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000005488   Gene: ENSMICG00000006018   Transcript: ENSMICT00000006017
Sequence length 543
Comment pep:known_by_projection genescaffold:micMur1:GeneScaffold_4516:143044:152469:1 gene:ENSMICG00000006018 transcript:ENSMICT00000006017 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLKERPGMAEEPQQQTGVPVVKLEKELPWGRTREDSSPETFRLRFRQFRYQEAAGPQEAL
RELQELCRQWLRPELHTKEQILELLVLEQFLTILPREFYTWIREHSLESGKALVAMVEDL
TERALEAKAVPCHVQGEQEETALCRGAWEPGVHLGPVEVKPEWGIPHGEGVQGLDQGTEE
RLNQDPGDRTQDFQELPILQAGPGLPSVNTRDQEVAAGFFTAGSQGLGPFKDMALVFPEE
EWRHVTPTQIDCFGEYVEPQDCGVSAGIGNKEKEAKPQQEELKGALAALPTERFGEADLQ
GSGLGRACEQEPGGSGGGVPGLAPPQHGALPLHDDLKTHSSFWKPFQCPECGKGFSRSSN
LVRHQRTHEEEKSYGCMECGKGFTLREYLMKHQRTHLGKRPYVCSECWKTFSQRHHLEVH
QRSHTGEKPYKCGDCWKSFSRRQHLQVHRRTHTGEKPYTCECGKSFSRNANLAVHRRAHT
GEKPYGCQVCGKRFSKGERLVRHQRIHTGEKPYHCPACGRSFNQRSILNRHQKTQHRQEP
PVQ
Download sequence
Identical sequences ENSMICP00000005488 ENSMICP00000005488

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]