SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000005715 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000005715
Domain Number 1 Region: 304-406
Classification Level Classification E-value
Superfamily SRCR-like 2.88e-37
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00025
Further Details:      
 
Domain Number 2 Region: 43-148
Classification Level Classification E-value
Superfamily SRCR-like 1.44e-35
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00023
Further Details:      
 
Domain Number 3 Region: 415-529
Classification Level Classification E-value
Superfamily SRCR-like 1.83e-24
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0014
Further Details:      
 
Domain Number 4 Region: 185-230
Classification Level Classification E-value
Superfamily SRCR-like 0.00000000000222
Family Scavenger receptor cysteine-rich (SRCR) domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000005715   Gene: ENSMICG00000006262   Transcript: ENSMICT00000006266
Sequence length 752
Comment pep:known_by_projection genescaffold:micMur1:GeneScaffold_4558:347299:366627:-1 gene:ENSMICG00000006262 transcript:ENSMICT00000006266 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRLVSVWQWSPWGLRLCLLCSLCLGSPSPSTDPEKRAGSQGLRFRLAGFPRKPYEGRVEI
QRAGEWGTICDDDFTLQAAHVLCRELGFTEATGWTHSAKYGPGTGRIWLDNLSCTGTEKS
VTECASRGWGNSDCTHDEDAGVICKDQRLPGFKDSNVIEVEHNPQVEEVRLRPGVGWGRR
PLPVTEGLVEVKLPDGWSQVCDKGWSAHNSHVVCGMLGFPSEKRVNTAFYXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXFYRANDTARCPGGGPAVSCVPGPLYAASSGQKKQQQSKP
QGEARVRLKGGAHPGEGRVEVLKAGTWGTVCDRKWDLQAASVVCRELGFGSAREALSGAR
MGQGMGAIHLSEVRCSGQEPSLWKCPHKNITADDCSHSQDAAVRCHLPYIGVEAKIRLSG
GRSRHEGRVEVQVGGPGSLRWGLICGDDWGTLEAMVACRQLGLGYANHGLQETWYWDSGN
ITEVVMSGVRCTGTELSLDQCAHHGTHITCKRAETRFTAGVICSETASDLLLHSALVQET
AYIEDRPLHMLYCAAEENCLASSARSANWPYGHRRLLRFSSQIHNLGRADFRPKAGRHSW
VWHECHGHYHSMDIFTHYDILTPNGTKVAEGHKASFCLEDTECQEDVSKRYECANFGEQG
ITVGCWDLYRHDIDCQWIDITDVKPGNYILQVVINPNFEVAESDFTNNAMKCNCKYDGHR
IWVHNCHIGDAFSEEANRRFERYPGQTSNQII
Download sequence
Identical sequences ENSMICP00000005715 ENSMICP00000005715

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]