SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000006505 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000006505
Domain Number 1 Region: 214-406
Classification Level Classification E-value
Superfamily Nudix 1.49e-44
Family NADH pyrophosphatase 0.0011
Further Details:      
 
Domain Number 2 Region: 1-52
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.00000000000117
Family Ankyrin repeat 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000006505   Gene: ENSMICG00000007149   Transcript: ENSMICT00000007141
Sequence length 412
Comment pep:known_by_projection scaffold:micMur1:scaffold_60404:5:1813:-1 gene:ENSMICG00000007149 transcript:ENSMICT00000007141 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LMYAARNGHLEVVQFLLEKGCDRSLVNTSRQTALDIAIFWGYKNIANLLANAEDGKKPWF
LTNGVEECENYFNKTLLDRKSEKRNNSDWLLSKESHPATVYILFSDLNPLVTLGGNKESF
QQPEVRLCQLNYTDVKDYLAQPEKITLIFLGVELEMKEKLLDTGEVPREEEDGLVAWFAL
SIDPTAAEEFKQRNENCYFLHPPMPALLQLKEKEAGVVAQARSVLAWHSRYKFCPTCGSA
TKIEEGGYKRVCLKEDCPSLQGVHNTSYPRVDPVVIMQVIHPDGTKCLLGRQKRFPPGMF
TCLAGFIEPGETIEDAVRREVEEESGVKVGHVQYVSCQPWPMPFSLMIGCLAVAVSTEIK
VDKNEIEDARWFTREQVVDVLTKGKQQAFFVPPSRAIAHQLIKHWVRINPNL
Download sequence
Identical sequences ENSMICP00000006505 ENSMICP00000006505

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]