SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000006706 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000006706
Domain Number 1 Region: 301-355
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.0000000216
Family SAM (sterile alpha motif) domain 0.0052
Further Details:      
 
Domain Number 2 Region: 879-909
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000366
Family Retrovirus zinc finger-like domains 0.0038
Further Details:      
 
Domain Number 3 Region: 100-218
Classification Level Classification E-value
Superfamily PX domain 0.00000654
Family PX domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000006706   Gene: ENSMICG00000007362   Transcript: ENSMICT00000007371
Sequence length 933
Comment pep:known_by_projection genescaffold:micMur1:GeneScaffold_1790:87324:121755:-1 gene:ENSMICG00000007362 transcript:ENSMICT00000007371 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAFNHRGLHFQQKQVLPPGSTRIQNSLEAGGGGPGGKGLPGAGGPPPCPAAWRGPWVSPR
PEAPVGGVGNSLESALHTSAHSTEESLPKRPLGKHGKVSVEKIDLKGLSHTKNDRNVECS
FEVLWSDSSITSVTKSSSEVTEFISKXXXXXXXXXXXXXXXXXXXXXXXXXXXXHMDLEA
GLRYLASLPSHVLKNDHVKKFFSTSSPTQQLQSPSPGNPSLSKVGTMMGVAGRPVCGVAG
IPSSQSGAQHHVQHPAGPAPALPHCSHAGGAGSALAYRAQMDASPAILMPPSLQAPQTQE
QNGILDWLRKLRLHKYYPVFKQLTMEKFLSLTEEDLNKFESLTMGAKKKLKTQLELEKEK
SERRCLNPSAPSLVTSSGVARVPPTSHVGPVQALRVEVEQPPHQLPREGSSSEYSSSSSS
PMGVQAREESSDSAEENDRRVEIHLEGPDKEKPVMLLNHFTPSNARPTAQVLPVQNEAGS
APAGHHPLPPQMMGAASHVAPMRMLSSVHKSERGNADMKLLSSSVHSLLSLEDRNKGSGP
RSGVKVDKSFGGAMVDALPPPTPHQPVQVLSGLSEGGSMSPTVSFGPRAKVVHASTLDRV
LKSAQQPALVVETSTAAPGTPSTVLHAAPPIKLLLSSSPAEPAISGQTCPSVQISVPGIS
PPTALYTANTKVAFSAMSMPVGALQGGFCANSSTASPSSHPSTSFANMASLPSCPAPSSS
PALSSVPESSFYSSSGGSSSTGNIPASNPGHHHHHHHQQPPAPPAPAPPPPGCIVCTSCG
CSGSCGSGALTVSYANYFQHPFSGPSMFPISFVSFNPSYVSAKQYGGGSIFRVVHAPYSS
SGTPEPVLGGQSTFAVPPMPNFMAGTGGVYQAQGLVGSSNGSSHKKSGNLSCYNCGATGH
RAQDCKQPSMDFNRQGTFRLKYAPPAEGLDSAD
Download sequence
Identical sequences ENSMICP00000006706 ENSMICP00000006706

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]