SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000006901 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000006901
Domain Number 1 Region: 412-547
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 1.17e-30
Family Nuclear receptor ligand-binding domain 0.000000179
Further Details:      
 
Domain Number 2 Region: 235-261,302-365
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 0.0000000000000174
Family Nuclear receptor ligand-binding domain 0.0000686
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000006901   Gene: ENSMICG00000007592   Transcript: ENSMICT00000007587
Sequence length 595
Comment pep:known_by_projection genescaffold:micMur1:GeneScaffold_3936:31083:325129:1 gene:ENSMICG00000007592 transcript:ENSMICT00000007587 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTMTLHSKASGMAMLHQIQGNELEPLNRPQLKIPLERPLGEVYVDSSKPAVYNYPEGAAY
EFNAAAAASAPVYGQSGLAYGPGSEAPPFGANGLGGFPPLNSVSPSPLVLLQTPPQLSPF
LQPHGQQVPYYLENEPSGYAVREAGPPAFFRPNSDNRRQGGRERLASANDKGSMAXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXHNDYMCPATNQCTIDKNRRKSCQAC
RLRKCYEVGMMKGGIRKDRRGGRMLKHKRQRDDGEGRNEAGPSGDMRAASLWPSPLLIKH
TKKNSPALSLTADQMVSALLEAEPPILYSDYDPTRPFSEASMMGLLTNLADRELVHMINW
AKRVPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNQGKCVEG
MVEIFDMLLATSSRFRMMNLQGEEFVCLKSIILLNSGVYTFLSSTLKSLEEKDHIHRVLD
KITDTLIHLMAKAGLTLQQQHRRLAQLLLILSHFRHMSNKGMEHLYNMKCKNVVPLYDLL
LEMLDAHRLHAPTGRTGVPMEEANQGQLATPGSTSSHSLQKYYATGEAESFPTTA
Download sequence
Identical sequences ENSMICP00000006901 ENSMICP00000006901

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]