SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000009666 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000009666
Domain Number 1 Region: 181-304
Classification Level Classification E-value
Superfamily Dystroglycan, domain 2 4.97e-60
Family Dystroglycan, domain 2 0.000000357
Further Details:      
 
Domain Number 2 Region: 62-160
Classification Level Classification E-value
Superfamily Cadherin-like 6.75e-19
Family Dystroglycan, N-terminal domain 0.00000274
Further Details:      
 
Domain Number 3 Region: 496-596
Classification Level Classification E-value
Superfamily Cadherin-like 8.16e-19
Family Dystroglycan, N-terminal domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000009666   Gene: ENSMICG00000010618   Transcript: ENSMICT00000010612
Sequence length 894
Comment pep:known_by_projection genescaffold:micMur1:GeneScaffold_3652:4997:22785:1 gene:ENSMICG00000010618 transcript:ENSMICT00000010612 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TRMSVALSLLLPLWGRTFLLLLSVAMAQSRWPSEPSEAIRDWENQLEASMHSVLSDLHEA
VPTVVGIPDGTAVVGRSFRVTIPTDLISSSGEVIKVSAAGKEALPSWLHWDPQSHTLEGL
PLDTDKGVHYISVSAARLGANGSHVSQTSSVFSIEVYPEDHSEPQSVRAASPDPAELVSS
ACAADEPVTVLTVILDADLTKMTPKQRIELLHRMRSFSEVELHNMKLVPVVNNRLFDMSA
FMAGPGNAKKVVENGALLSWKLGCSLNQNSVPDIHGVEAPAREGTMSAQLGYPVVGWHIA
NKKPPLPKRIRRQIHATPTPVTAIGPPTTAIQEPPSRIVPTPTSPAIAPPTETVAPPVRD
PVPGKPTVTIRTRAIVQTPTLSIIQPTRVSEAGTTIPGQIRPTMTIPGYVEPTAVATPPT
TTTKKPRVSTPKPAMPSTDSSTTTTRRPTKKPRTPRPVPRVTTKAPITRLETASPPTRIR
TTTSGVPRGGEPNQRPELKNHIDRVDAWVGTYFEVKIPSDTFYDNEDTTTDKLKLTLKLR
EQQLVGEKSWVQFNSNSQLMYGLPDSSHVGKHEYFMHATDKGGLSAVDAFEIHVHRRPQG
DKAPARFKAKFVGDPGPVVSDIHKKIALVKKLAFAFGDRNCSTITLQNITRGSIVVEWTN
NTLPLEPCPKEQIMGLCRRIAEDDGKPRPTFSNALEPDFKAMSISVMGSGSCRHLQFIPV
APPRRVPSEAPPTEVPDRDPEKSSEDDVYLHTVIPAVVVAAILLIAGIIAMICYRKKRKG
KLTLEDQATFIKKGVPIIFADELDDSKPPPSSSMPLILQEEKAPLPPPEYPNQSVPETTP
LNQDTMGEYTPLRDEDPNAPPYQPPPPFTAPMEGKGSRPKNMTPYRSPPPYVPP
Download sequence
Identical sequences ENSMICP00000009666 ENSMICP00000009666

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]