SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000009739 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000009739
Domain Number 1 Region: 285-388
Classification Level Classification E-value
Superfamily SRCR-like 2.49e-39
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0000866
Further Details:      
 
Domain Number 2 Region: 1-101
Classification Level Classification E-value
Superfamily SRCR-like 3.79e-39
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00013
Further Details:      
 
Domain Number 3 Region: 414-516
Classification Level Classification E-value
Superfamily SRCR-like 5.89e-38
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000009739   Gene: ENSMICG00000010692   Transcript: ENSMICT00000010687
Sequence length 517
Comment pep:novel genescaffold:micMur1:GeneScaffold_3810:161548:168022:-1 gene:ENSMICG00000010692 transcript:ENSMICT00000010687 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LRLVGGPSRCRGRLEVLHGGSWGSVCDDDWDVVDANVVCRQLGCGLALPVPQPLAFGQGR
GPILLDNVECRGQEAALSECGSRGWGVHNCFHYEDVAVLCDXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLGLPTLS
ALPPSATREDGAWHSEPAATGVGPQPSREPALSTTAAWPAGKRSGRLRLVGGPGPCRGRV
EVLYAGGWGTVCDDDWDFADARVACREAGCGPALGATGLGHFGYGRGPVLLDNVGCAGTE
ARLSDCFHLGWGQHNCGHHEDAGALCAXXXXXXXXXXXXXXXXXXXXXXXXXXXHLRLAN
GAHRCEGRVELFLGQRWGTICDDAWDLRAASVLCRQLGCGQALAAPGEAHFGPGRGPILL
DNVKCRDESTLLLCSHIRWDAHNCDHSEDASVLCRPS
Download sequence
Identical sequences ENSMICP00000009739 ENSMICP00000009739

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]