SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000010366 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000010366
Domain Number 1 Region: 196-317
Classification Level Classification E-value
Superfamily Class II aaRS ABD-related 8.1e-49
Family Anticodon-binding domain of Class II aaRS 0.000000436
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000010366   Gene: ENSMICG00000011390   Transcript: ENSMICT00000011387
Sequence length 579
Comment pep:known_by_projection genescaffold:micMur1:GeneScaffold_3891:319025:338050:-1 gene:ENSMICG00000011390 transcript:ENSMICT00000011387 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNTAPSRPSPTRRDPYGFGDSRDSRRDRSPIRGSPRREPRDGRNGRDARDSRDIRDPRDL
RDHRDSRDIRDHRDSRSMRDARDMRDLRDFRDLRDSRDFRDHRDPMYDRYRDMRDSRDPM
YRREGSYDRYLRMDDYCRRKDDSYFDRYRDSFDGRGPPGPESHSRAKERLKREERRREEL
YRQYFEEIQRRFDAERPVDCSVIVVNKQTKDYAESVGRKVRDLGMVVDLIFLNTEVSLSQ
ALEDVSRGGSPFAIVITQQHQIHRSCTVNIMFGTPQEHRNMPQADAMVLVARNYERYKNE
CREKEREEIARQAAKMADEAILQERERGGPDEGVRGGHPPAIQSLINLLADNRYLTAEET
DKIINYLRERKERLMRSSTDSLPGPISRQSLGATSGASLKTQPSPQPLQSGQVLPSATPT
PAAPPTSQQELQAKILSLFNSGTVAANSSSASPSVVTGSTQNQNFSTAANSQPQQRSQAS
GNQPPNILGQAGSARNMGPRPGAPSEGLFGQPSSRLAPPSNMASQRPVSSISINFDNPSV
QKALDTLIQSGPALSHLVSQTTAQVGQPQAPMGSYQRHY
Download sequence
Identical sequences XP_012598453.1.48125 ENSMICP00000010366 ENSMICP00000010366

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]