SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000012896 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000012896
Domain Number 1 Region: 34-125
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 6.41e-38
Family SCAN domain 0.0000424
Further Details:      
 
Domain Number 2 Region: 471-528
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.57e-25
Family Classic zinc finger, C2H2 0.0039
Further Details:      
 
Domain Number 3 Region: 613-669
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.64e-23
Family Classic zinc finger, C2H2 0.0036
Further Details:      
 
Domain Number 4 Region: 574-626
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.23e-18
Family Classic zinc finger, C2H2 0.0044
Further Details:      
 
Domain Number 5 Region: 434-485
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.24e-18
Family Classic zinc finger, C2H2 0.0057
Further Details:      
 
Domain Number 6 Region: 211-264
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.000000000000615
Family KRAB domain (Kruppel-associated box) 0.0044
Further Details:      
 
Domain Number 7 Region: 517-560
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000398
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 
Domain Number 8 Region: 375-418
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000835
Family Classic zinc finger, C2H2 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000012896   Gene: ENSMICG00000014148   Transcript: ENSMICT00000014144
Sequence length 684
Comment pep:known_by_projection genescaffold:micMur1:GeneScaffold_3837:17957:24530:1 gene:ENSMICG00000014148 transcript:ENSMICT00000014144 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSGPGSQEREGLLIVKLEEDCAWSQELPPPDPGPSPEASHLRFRRFRFQEAAGPREALS
RLQELCHGWLRPEMRTKEQILELLVLEQFLIILPQEIQSRVQELHPESGEEAVTLVEDMQ
RELGRLRQQVTNHGRGTEVILEEPLPLETARESPSFKLEPMETERSPGPRLQELLGPSPK
RDPQAVKERALSAPWLSLFPPEGNIEDKEMTGPQLPESLEDVAMYISQEEWGHQDPSKRA
LSRDTVQESYENVDSLESHVPSQEAPATRVEHGEKPWDPSGQSCSEGLSPGSPAPGEEKF
ENLEESAQSVSLENTHPQALLPGQAGGEVPWSPEQGRPHGGAEGDWQPPPEGPMEQSLAG
ATGYRELGRPRELQPKKLHLCPLCGKNFSNNSNLIRHQRIHAAERLCMGVECGEIFGGNP
HFLSLHRAHLGEEAHKCLECGKCFSQNTHLTRHQRTHTGEKPYQCNICGKSFSCNSNLHR
HQRTHTGEKPYKCPECGEIFAHSSNLLRHQRIHTGERPYKCPECGKSFSRSSHLVIHERT
HEKERLYAFSECGGAINDSAPFLTNHGVHKAEKKLFQCLTCGKSFRQGMHLTRHQRTHTG
EKPYKCTLCGENFSHRSNLIRHQRIHTGEKPYTCHECGDSFSHSSNRIRHLRTHTGERPY
KCSECGESFSRSSRLMSHQRTHTG
Download sequence
Identical sequences ENSMICP00000012896 ENSMICP00000012896

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]