SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000012934 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000012934
Domain Number 1 Region: 211-356
Classification Level Classification E-value
Superfamily ThrRS/AlaRS common domain 9.03e-31
Family AlaX-like 0.022
Further Details:      
 
Domain Number 2 Region: 2-113
Classification Level Classification E-value
Superfamily HSP20-like chaperones 2.07e-21
Family Co-chaperone p23-like 0.00019
Further Details:      
 
Domain Number 3 Region: 152-209
Classification Level Classification E-value
Superfamily Translation proteins 0.000000000636
Family AlaX-M N-terminal domain-like 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000012934   Gene: ENSMICG00000014185   Transcript: ENSMICT00000014188
Sequence length 525
Comment pep:novel genescaffold:micMur1:GeneScaffold_4661:90666:114357:-1 gene:ENSMICG00000014185 transcript:ENSMICT00000014188 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEFCVEDSTDVYVLIEDHRIVFSCKNADGVELYNEIEFYAKVNSKDSQDKRSCRSITCFV
RKWKEKVAWPRLTKEDIKPVWLSVDFDNWRDWEGDEEVELAHVEHYAELLKKVSTKRPPP
AMDDLDFATTVVSCSPAELQTEGSNGKKEVLSGFQVVLEDTLLFPEGGGQPDDRGTINDI
SVLRVTRRGAQADHFTQTPLTPGSQVLVRVDWERRFDHMQQHSGQHLITAIADHLFELKT
TSWELGRLRSVIELDSPSVTAEQVAAIEQSVNEKIRDRLPVNVRELSLDDPEVEQVRGRG
LPDDHAGPIRVITIKGVDSNMCCGTHVSNLSDLQVIKILGTEKGKKNKTNLIFLAGNRVL
KWMERSHGTEKALTTLLKCGAEDHVEAVKKLQNSTKLLQKNNLNLLRDLAVHIAHSLRNS
SDWGGVVALHRKEGDSEFMNIIANEIGSEETILFLTVGDEKGAGLFLLAGPAEAVETLGP
RVAEVLEGKGAGKKGRFQGKATKMSRRAEAQALLQDYVSTQSAEE
Download sequence
Identical sequences ENSMICP00000012934 ENSMICP00000012934

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]