SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000014537 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000014537
Domain Number 1 Region: 29-281
Classification Level Classification E-value
Superfamily SIS domain 0.000000000494
Family mono-SIS domain 0.0011
Further Details:      
 
Domain Number 2 Region: 297-438
Classification Level Classification E-value
Superfamily SIS domain 0.0000000139
Family mono-SIS domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000014537   Gene: ENSMICG00000015947   Transcript: ENSMICT00000015947
Sequence length 474
Comment pep:known_by_projection genescaffold:micMur1:GeneScaffold_1280:170174:180857:1 gene:ENSMICG00000015947 transcript:ENSMICT00000015947 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPATKRFQHVIETPEPGKWELSGYEAAVPITEKSNPLTQDLDKADAEKIVQLLGQCDAEI
FQEEGQGMPTYQRLYSESILTTMVQVAGKVQEVLKEPDGGLVVLSGGGTSGRMAFLMSVS
FNQLMKGLRQKPLYTYLIAGGDRSLVASREGTEDSAMHGIEELKKVAAGKKKVIVIGISV
GLSAPFVAGQMDYCMDNTAVFLPVLVGFNPVSMARNDPIEDWSSTFRQVAERMQKMQEKQ
KAFVLNPAVGPEGLSGSSRMKGGSATKILLETLLLAAHKTVDRGIEASQRCLLEILWTFE
RAHQVTYSQSARIATLMKQVSTSLERKGRTYLVGWQTLGIIAIMDGVECIHSFGADFRDI
RGFLIGDHSDMFNQKAELTNQGPQFSFSQEDFLTSILPTLTDIDTVVFIFTLDDNLTEVQ
TLVEQVKEKTTNIQALVHSTVGQSLPTPLKKLFPSIISITWPLLFFEYEGNFIQ
Download sequence
Identical sequences ENSMICP00000014537 ENSMICP00000014537

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]