SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000015042 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000015042
Domain Number 1 Region: 1122-1290
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 2.35e-24
Family BCR-homology GTPase activation domain (BH-domain) 0.0017
Further Details:      
 
Domain Number 2 Region: 906-1037
Classification Level Classification E-value
Superfamily PH domain-like 1.15e-22
Family Pleckstrin-homology domain (PH domain) 0.016
Further Details:      
 
Domain Number 3 Region: 684-799
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 7.46e-18
Family Pyk2-associated protein beta ARF-GAP domain 0.0087
Further Details:      
 
Domain Number 4 Region: 5-74
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.00000000000000105
Family SAM (sterile alpha motif) domain 0.0000585
Further Details:      
 
Domain Number 5 Region: 1429-1532
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000022
Family Pleckstrin-homology domain (PH domain) 0.02
Further Details:      
 
Domain Number 6 Region: 496-557
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000356
Family Pleckstrin-homology domain (PH domain) 0.000091
Further Details:      
 
Domain Number 7 Region: 626-682
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000411
Family Pleckstrin-homology domain (PH domain) 0.018
Further Details:      
 
Domain Number 8 Region: 1014-1114
Classification Level Classification E-value
Superfamily PH domain-like 0.00000015
Family Pleckstrin-homology domain (PH domain) 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000015042   Gene: ENSMICG00000016496   Transcript: ENSMICT00000016504
Sequence length 1700
Comment pep:known_by_projection genescaffold:micMur1:GeneScaffold_200:118735:297762:-1 gene:ENSMICG00000016496 transcript:ENSMICT00000016504 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSVSEVNVDIKDFLMDINLEQYLLPFREFGFNTVRDCAAINDSVLHRIGISPTGHRRRI
LKQLQIILSKMQDMSIYANVHKTKKNDDTSKDRHAASPDQNTCVDLSESGSVLTVSPPQL
ETVTKSLDENDVSVENSQPLQPDDKLSLSKHDLPVSEEPHPNVESFHDSFFGSENIKIES
LITKKTMDCTVEEQQTEKVNFIMENLSKLPKADSECISSVGCSTSEANSGKGPNGVLERS
PPSPFFQFQGEMVVNDLYVPSSPILSPMRSRSKLVSRPSRSFLLRHRPVPEIPGPTKGGS
YFRERRNVATSTGKSVTWQXXXXXXXXXXXXXXXXXXXXXXXXXXKRSIKNEFWTHEETL
KGKSSTAGNSFIIRSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXKRMFQKRWVKFDGLSISYYNNEKEMYSKGIIPLSAISTVRVQGDNK
FEVVTTQRTFVFRVEKEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXDFKSGLGITIIPMNVANVKQVDRTVKQSFEIITPYKSFSFTAE
SEKEKQDWIEAVQQSIAETLSDYEVAEKIWFNESNRSCADCKAPDPDWASINLCVVICKK
CAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLFIVIGNKRANDFWAGNLQKDEELHMDSP
VEKRKNFITQKYKEGKFRKTLLASLTKEELNKXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXLQMEFLYHNKFSDFPQHDTHPEGGLNQESSQSTFLCDFLYQA
PAAVSKLSSEKKLLEETNKKWCVLEGGFLSYYENDKSTTPYGTININEVICLAIQKEDFY
LNTGPIFIFEIYLPSERVFLFGAETSQAQRKWTEAIAKHFVPLFAENLTEADYDLIGQLF
YKDCHALDQWRKGWFAMDKSSLHFCLQMQEVQEDRMHLRRLQELTISTMVQNGEKLDVLL
LVEKGRTLYIHGHTKLDFTVWHTAIEKAAGTDGNALQDQQLSKNDVPIIVNSCIAFVTQY
GLGCKYIYQKNGDPLHISELVESFRKDARSFKLRAGKHQLEDVTGVLKSFLCDIDDALLT
KELYPYWISALXXXXXXXXXXXXXXXXXXXXXXXXXXXAAIIEHLYRVQKCSEINHMNAH
NLAIFSNSLFQTKGRANEEANVMEVLINTVQIFXXXXXXXXXXXXXXXXXXXXXXXXVSQ
AGDLLIEVYVERKEPDCSIIIRISPVMEAEELTNDVLAIKNIIPTKGDFWATFEVIENEE
LERPLHYTENVLEQVLRWSSLAEPGSAYLVVKKFLTMDTIKHYSERSALESIKEGVLKIK
EEPSKILSGNKFQDRYFVLRDGCLFLYKDMKXXXXXXXXXXXXXXXXXXVRKKKPPTSWG
LTAYSEKHHWHLCCDSSQTQIEWMASVFIAQXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXSARAELERLRLSEKPERAPGDASLRERASMVAQCLEHKDDRLRS
RTRKHRSFNCLEDTETEALHGQQKGHKGLKTLRKTEDRNSKATLDSDHKLPSKVIEELSV
VLQRSRTLQKELQGEQTLQK
Download sequence
Identical sequences ENSMICP00000015042 ENSMICP00000015042

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]