SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000015171 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000015171
Domain Number 1 Region: 49-98
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.000000000000222
Family HLH, helix-loop-helix DNA-binding domain 0.003
Further Details:      
 
Domain Number 2 Region: 105-153
Classification Level Classification E-value
Superfamily Orange domain-like 0.000000144
Family Hairy Orange domain 0.00039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000015171   Gene: ENSMICG00000016651   Transcript: ENSMICT00000016649
Sequence length 322
Comment pep:known_by_projection genescaffold:micMur1:GeneScaffold_3691:582599:605694:-1 gene:ENSMICG00000016651 transcript:ENSMICT00000016649 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKAPREPDRFERYSDPIDVGREGELXXXXXXXXXXXXXXXXXXXXXXGIIEKRRRDRINS
SLSELRRLVPTAEKQGSSKLEKAEVLQMTVDHLKMLHATGGTGFFDARALAVDFRSIGFR
ECLTEIRYLGSVPSSADPVRIRLLSHLNSYAAEMEPSPTPTGPLAFPAWPWSFFHSCPGL
PALSSQLAILGRVPGSVLPGATSPTYPIPALRSTPIRRATGTILTPRRNLLASRGASSAR
RARPPERPAAPVPVAPSSRAARSSHLAPLLQSSSPTPPGAVGSTAYVAVPATSPSSPGPA
GRPAGAMLYRSWVSEITEIGAF
Download sequence
Identical sequences ENSMICP00000015171 ENSMICP00000015171

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]