SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000015617 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000015617
Domain Number 1 Region: 918-1045,1241-1307
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 4.71e-29
Family p120GAP domain-like 0.024
Further Details:      
 
Domain Number 2 Region: 2-82
Classification Level Classification E-value
Superfamily Sema domain 2.22e-17
Family Sema domain 0.011
Further Details:      
 
Domain Number 3 Region: 523-607
Classification Level Classification E-value
Superfamily E set domains 3.5e-16
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.05
Further Details:      
 
Domain Number 4 Region: 79-131
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000000000000654
Family Plexin repeat 0.0015
Further Details:      
 
Domain Number 5 Region: 423-472
Classification Level Classification E-value
Superfamily E set domains 0.00000000028
Family Other IPT/TIG domains 0.019
Further Details:      
 
Domain Number 6 Region: 605-707
Classification Level Classification E-value
Superfamily E set domains 0.00000000966
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.041
Further Details:      
 
Domain Number 7 Region: 704-778
Classification Level Classification E-value
Superfamily E set domains 0.0000115
Family E-set domains of sugar-utilizing enzymes 0.097
Further Details:      
 
Domain Number 8 Region: 377-409
Classification Level Classification E-value
Superfamily Plexin repeat 0.000085
Family Plexin repeat 0.0031
Further Details:      
 
Weak hits

Sequence:  ENSMICP00000015617
Domain Number - Region: 221-254
Classification Level Classification E-value
Superfamily Plexin repeat 0.0222
Family Plexin repeat 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000015617   Gene: ENSMICG00000017140   Transcript: ENSMICT00000017145
Sequence length 1460
Comment pep:known_by_projection genescaffold:micMur1:GeneScaffold_4678:441575:804802:-1 gene:ENSMICG00000017140 transcript:ENSMICT00000017145 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTSVIAYVYKNHSLAFVGTKSGKLKKIRVDGPRGGALQYETVQVVDPGPVLRDMAFSKDH
EQLYIMSERQLTRVPVESCGQYRSCGECLGSGDPHCGWCVLHNTCTRKERCERSREPRRF
ASEMKQCVRLTVHPSNISVSQYNVLLVLETYNVPELSAGVNCTFEDLSEMDGLVVGNQIQ
CYSPAATEMPRILTENXXXXXXXXXXXXXXXXXXFASTSFVFYCSVHNSCLSCVESPYRC
HWCKYRHVCTHDPKTCSFQEGRVKLPEDCPQLLRVDKILVPVEVIKPITLKAKNLPQPQS
GQRGYECVLNIQGSEERVPALRFNSSSVQCQNTSYSYEGMEINNLPVELTVVWNGHFNID
NPAQNKVHLYKCGAMRESCGLCLKADPDFACGWCQGPGQCTLRQHCPAQESRWLELSGPN
SKCTNPRITEIIPVTGPREGGTKVTIRGENLGLEFRDIASHVKVAGVECSPLVDGYIPAE
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTLTLSDLKPSRGPMSGGTQV
TITGTNLNAGSNVVVMFGKQPCLFHRRSPSYIVCNTTSSDEVLEMKVMVQVDRAKIHQDL
VFQYVEDPTIVRIEPEWSIVSGNTPIAVWGTHLDLIQNPQIRAKHGGKEHINICGGLTHE
MTQAPALALGPDHQSDLTERPEEFGFILDNVQSLLILNKTNFTYYPNPVFEAFGPSGILE
LKPGTPIILKGKNLIPPVAGGNVKLNYTVLVGEKPCTVTVSDVQLLCESPNLIGRHKVMX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXFAELQTDIHELTSDLDGAGIPFLDYRTYTMRVLFPGIEDHPV
LRDLEVPGYRQERVEKGLKLFAQLINNKVFLLSFIRTLESQRSFSMRDRGNVASLIMTVL
QSKLEYATDVLKQLLADLIDKNLESKNHPKLLLRRTESVAEKMLTNWFTFLLYKFLKECA
GEPLFSLFCAIKQQMEKGPIDAITGEARYSLSEDKLIRQQIDYKTLVLSCVSPDNANSPE
VPVKILNCDTITQVKEKILDAIFKNVPCSHRPKAADMDLEWRQGSGARMILQDEDITTKI
ENDWKRLNTLAHYQVPDGSVVALVSKQVTAYNTVNNSTVSRTSASKYENMIRYTGSPDSL
RSRTPMITPDLESGVKMWHLVKNHEHGDQKEGDRGSKMVSEIYLTRLLATKGTLQKFVDD
LFETIFSTAHRGSALPLAIKYMFDFLDEQADKHGIHDPHVRHTWKSNXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXY
YSDIGKMPAISDQDMNAYLAEQSRMHMNEFNTMSALSEIFSYVGKYSEEILGPLDHDDQC
GKQKLAYKLEQVITFMSLDS
Download sequence
Identical sequences ENSMICP00000015617 ENSMICP00000015617

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]