SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|MicpuC3|172307|estExt_Genewise1.C_10_t20313 from Micromonas pusilla CCMP1545 v3.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|MicpuC3|172307|estExt_Genewise1.C_10_t20313
Domain Number 1 Region: 53-625
Classification Level Classification E-value
Superfamily SIS domain 2.22e-169
Family Phosphoglucose isomerase, PGI 0.00000000077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|MicpuC3|172307|estExt_Genewise1.C_10_t20313
Sequence length 657
Sequence
MSAFATLHHVPARAYKMSKRANDGSKKLRGALMTTRGAPGASFSEGEPPALISTTPEWDA
LKRHKEEIIDGTHLRELLNDEERNEALTAEYNGVYCDFARQRVVPETMEKLYDLANAAGL
KDKINAMFEGEHINSTEDRAVLHVATRAPRDKVINVDGKNVVPQVWDVLDKIKDFTDKVR
DGEWVGATGKPLTSVVAVGIGGSFLGPLFVHTSLRTCPEAAEGARGRQLRFLANVDPVDV
ARSLNGLDPETTLVVVVSKTFTTAEARSISRRSPYGRGGTMLNARTVRTWITASLGKEAV
KKHMVAVSTNLKLVSEFGIDPDNAFGFWDWVGGRYSVCSAVGMLPLSLQYGFDTMEKFLE
GAWNIDEHFATAPFEKNLPVTLGMLSVWNVSFLGCSARAILPYTQALAKLAPHIQQVAME
SNGKGVSIDGRRVPRTGPHTAPPLPYDTGEIDFGEPGTNGQHSFYQLIHQGRTIPCDFIG
IIKSQQSVYLKGEIVSNHDELMCNFFAQADALAVGKTDVELRSENVPTFLIPHKTFTGNR
PSLSIMLPALNAYSTGQLLAIYEHRVAVQGFVWGLNSFDQWGVELGKVLASKVRVSMSQK
RTTGELEGSSDGFNSSTTAMLNRYLKGKAQLKYAEAEDVFPCDLIDSDECRPPTSYV
Download sequence
Identical sequences jgi|MicpuC3|172307|estExt_Genewise1.C_10_t20313

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]