SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|MicpuC3|25777|MicpuC2.estExt_Genewise1.C_30648 from Micromonas pusilla CCMP1545 v3.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|MicpuC3|25777|MicpuC2.estExt_Genewise1.C_30648
Domain Number 1 Region: 313-683
Classification Level Classification E-value
Superfamily SIS domain 8.44e-92
Family double-SIS domain 0.000000511
Further Details:      
 
Domain Number 2 Region: 2-209,246-290
Classification Level Classification E-value
Superfamily N-terminal nucleophile aminohydrolases (Ntn hydrolases) 4.87e-53
Family Class II glutamine amidotransferases 0.0000148
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|MicpuC3|25777|MicpuC2.estExt_Genewise1.C_30648
Sequence length 683
Sequence
MCGIFAYVNYGVPTQQKAIVDKLLNGLRRLEYRGYDSAGIAVDNGPTVDQLSPVVLKETG
KIDELQKHIEGRAAELHGDLYFENHCGIGHTRWATHGPPAPKNSHPHTSDVANEFLVVHN
GIITNHGALKAMLEKKGYAFESDTDTEVIPKLTKFLFDKFAPRRITFRQLVMEVVRQLHG
AFALIFKSTHYPGELVAAKRGSPLLLGIVEEKKTSVSVVTSEGYRTSNAGDNDADEAPDA
KRRKNAPRKQHLEFYFASDASAMVEHTKRVLHLEDDDVAHLHDGGYGIYRMERSAEVERT
VETLKMELENIMKGEFEHFMKKEIHEQPESVVQTMMGRVVKDMEGAASRVFLGGMINFVS
TIRRSRRIVLCGCGTSYNSAIAVRQLMEELTELPVTLELASDVLDRRCPFFRDDTCVFIS
QSGETADTLKAMQYAKDRGALCVGIVNTVGSAISRSTDCGVHINAGAEIGVASTKAYTCQ
IVAMVLLSLSLSEDSMSLHSRRKRIMSSLLELPNAIRKALLLDAQMRELAKELKDENSLL
LLGRGYNYATALEGALKVKEVALLHSEGILAGEMKHGPLALVDEVLPLIIVATMDDSYKK
QESAVQQLRARGGRLILIVSEEDDEIAKTAGDKATIVRVPTVEDCLQSVVNIVPLQLLSY
HLTVLRGHNVDQPRNLAKSVTVE
Download sequence
Identical sequences C1MM62
XP_003057344.1.6386 jgi|MicpuC3|25777|MicpuC2.estExt_Genewise1.C_30648

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]