SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|MicpuC3|53602|MicpuC2.EuGene.0000150277 from Micromonas pusilla CCMP1545 v3.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|MicpuC3|53602|MicpuC2.EuGene.0000150277
Domain Number - Region: 649-701
Classification Level Classification E-value
Superfamily SIS domain 0.000111
Family mono-SIS domain 0.0045
Further Details:      
 
Domain Number - Region: 131-199
Classification Level Classification E-value
Superfamily SIS domain 0.00311
Family mono-SIS domain 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|MicpuC3|53602|MicpuC2.EuGene.0000150277
Sequence length 813
Sequence
MEEGLASSSSSEDDADEPPPRAEENLPPLFHEAAGPPPEEETPITERPNPATDFIDAQAT
TADLARLLTQCDREMYGMPTGDVLGHAGLGSAHFARMFGQLTDQIVEYVRLNQQGATIEA
TTPGKWRPRAVVFIVGCGTSGRLAFQASRAGNAALKARGHAPMFRHVVAGGDAALFQCVE
SAEDDGARARDDYDAALAAAGGDAITDAFMIGISAGLSARYVAEMLNRAFDDPKHRFAVA
FLGFNPSNQARERAMFHPPSPRFQRRATLLPGVAPVDPTDWMMGKDRPEDVYGPKPIRPA
SFREVVWRFELDIGGQYCGVGDDDDESTQTMRYRRRLALNPVLGPEAVTGSSRLKGGSAT
KVILDASIHAAIALACDVKTTEEIGFPIRATRGATALTRDCVCVASRATRAVSQAAQDDD
SPLSQARRLIDAAADALRAKAGVHYLASDSVGVGLTCAIDASEQEPTFGAKKTDVRAYVR
GGWQVVTGSMRVPAGVDADLDVSESPGFRAAAGSFGADDLIVVFVTGGEDSASKRSSDSD
ARDGDGDGDGGSSSTSSSSIVDVVADVVAEKGCRVAVVAVGVKGHDDAIARAETIRATFA
AAAETAHRTRRAAERATLATCAIEIDPALGPELGCYEEQSQILSFAPRAVELAVKHVANA
VSTGAHVLIGKTFGNRMIDLRVSNAKLFRRAARLIEDLTGVSDVDARVALSRAIHGDPAP
AVDDAALDAHVRVATGMRRVVPAATLLATGAPWKDVVDARVAVASGESVRVILTRAGFGG
KGGGGEGGASASKRAKTTDAAATSKGAAYQFAF
Download sequence
Identical sequences C1N793
XP_003063697.1.6386 jgi|MicpuC3|53602|MicpuC2.EuGene.0000150277

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]